Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FIV3

Protein Details
Accession A0A2T0FIV3   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-31GASKIRKRIRDLQRLLRKPGLHydrophilic
NLS Segment(s)
PositionSequence
16-19RKRI
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MAIQSLPSGAGASKIRKRIRDLQRLLRKPGLSATKKVETERALASFEQDLEKVKTRNVEKKNAQKYHMVRFFDKKKAIRRLKHDGQEALADWYYVTTFPISEKYSALYAEGAAGHGHAYYQAILARIESGELEKSPEAVAKILNKIKPKKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.47
4 0.55
5 0.6
6 0.67
7 0.7
8 0.73
9 0.75
10 0.8
11 0.81
12 0.8
13 0.76
14 0.66
15 0.56
16 0.55
17 0.54
18 0.47
19 0.46
20 0.46
21 0.46
22 0.48
23 0.48
24 0.46
25 0.38
26 0.37
27 0.34
28 0.29
29 0.24
30 0.22
31 0.22
32 0.17
33 0.16
34 0.14
35 0.12
36 0.13
37 0.14
38 0.18
39 0.17
40 0.18
41 0.24
42 0.29
43 0.38
44 0.4
45 0.47
46 0.5
47 0.6
48 0.69
49 0.66
50 0.63
51 0.62
52 0.6
53 0.61
54 0.59
55 0.52
56 0.44
57 0.47
58 0.5
59 0.49
60 0.51
61 0.46
62 0.49
63 0.57
64 0.63
65 0.62
66 0.64
67 0.67
68 0.69
69 0.7
70 0.65
71 0.55
72 0.47
73 0.42
74 0.35
75 0.28
76 0.2
77 0.14
78 0.09
79 0.09
80 0.08
81 0.06
82 0.06
83 0.04
84 0.04
85 0.05
86 0.09
87 0.11
88 0.12
89 0.12
90 0.13
91 0.13
92 0.13
93 0.13
94 0.1
95 0.08
96 0.08
97 0.08
98 0.07
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.04
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.08
116 0.09
117 0.09
118 0.1
119 0.13
120 0.12
121 0.13
122 0.13
123 0.15
124 0.15
125 0.14
126 0.17
127 0.18
128 0.26
129 0.32
130 0.36
131 0.44
132 0.51