Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7S0R9

Protein Details
Accession J7S0R9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
80-108VEGLKRRGKGAPKKMKKTDTASKGKKGKKBasic
NLS Segment(s)
PositionSequence
83-108LKRRGKGAPKKMKKTDTASKGKKGKK
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRQRLAKLYELSAKIFDQNFNPGRVRTGSKILSQRLKGPSVANYYGNPDFIKFRNLKSLFPGTEFIDPDEQYRLMKVEGLKRRGKGAPKKMKKTDTASKGKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.33
4 0.3
5 0.29
6 0.26
7 0.21
8 0.28
9 0.28
10 0.3
11 0.31
12 0.27
13 0.29
14 0.3
15 0.32
16 0.26
17 0.3
18 0.29
19 0.33
20 0.39
21 0.41
22 0.45
23 0.42
24 0.45
25 0.43
26 0.42
27 0.37
28 0.33
29 0.31
30 0.3
31 0.31
32 0.25
33 0.22
34 0.25
35 0.24
36 0.23
37 0.19
38 0.14
39 0.15
40 0.14
41 0.19
42 0.16
43 0.16
44 0.26
45 0.27
46 0.27
47 0.29
48 0.34
49 0.29
50 0.29
51 0.3
52 0.22
53 0.24
54 0.24
55 0.2
56 0.18
57 0.18
58 0.17
59 0.17
60 0.16
61 0.13
62 0.14
63 0.13
64 0.1
65 0.13
66 0.16
67 0.22
68 0.3
69 0.37
70 0.42
71 0.42
72 0.47
73 0.5
74 0.56
75 0.58
76 0.61
77 0.65
78 0.71
79 0.8
80 0.84
81 0.85
82 0.82
83 0.81
84 0.8
85 0.79
86 0.79
87 0.77
88 0.77