Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FJ23

Protein Details
Accession A0A2T0FJ23    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-40MAGGKSRKKTVKRVKDKAQHHVILHydrophilic
NLS Segment(s)
PositionSequence
17-32MAGGKSRKKTVKRVKD
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKVQTTKAAKAAAAMAGGKSRKKTVKRVKDKAQHHVILDQPLYDRIFKEAGASKFFTVSVLVDRLKVNGSLARRALKALEEEGIIKPVITHSKQKTYTRVAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.18
4 0.12
5 0.15
6 0.18
7 0.19
8 0.2
9 0.26
10 0.33
11 0.38
12 0.49
13 0.55
14 0.64
15 0.72
16 0.79
17 0.83
18 0.85
19 0.85
20 0.83
21 0.81
22 0.72
23 0.62
24 0.56
25 0.48
26 0.42
27 0.35
28 0.26
29 0.18
30 0.17
31 0.17
32 0.14
33 0.12
34 0.11
35 0.11
36 0.1
37 0.13
38 0.17
39 0.17
40 0.19
41 0.2
42 0.18
43 0.18
44 0.18
45 0.15
46 0.1
47 0.09
48 0.08
49 0.1
50 0.1
51 0.11
52 0.11
53 0.12
54 0.12
55 0.12
56 0.11
57 0.12
58 0.14
59 0.17
60 0.2
61 0.22
62 0.22
63 0.22
64 0.22
65 0.2
66 0.2
67 0.17
68 0.16
69 0.13
70 0.15
71 0.15
72 0.16
73 0.14
74 0.11
75 0.1
76 0.12
77 0.19
78 0.21
79 0.29
80 0.34
81 0.44
82 0.52
83 0.58
84 0.62