Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FFQ5

Protein Details
Accession A0A2T0FFQ5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
101-121GQRTRTNAKNAKKLNRLDRRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027437  30s_Rbsml_prot_S13_C  
IPR001892  Ribosomal_S13  
IPR010979  Ribosomal_S13-like_H2TH  
IPR018269  Ribosomal_S13_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00416  Ribosomal_S13  
PROSITE View protein in PROSITE  
PS00646  RIBOSOMAL_S13_1  
PS50159  RIBOSOMAL_S13_2  
Amino Acid Sequences MVTNIMGKSFRGNVLVQAGLVQKFFGVGHKTAGEICSKLGFYPRMRMHQLDEPRILALTKELSTLKIETELRNEILQNIRIKHEIGSYQGMRHAQGLPVHGQRTRTNAKNAKKLNRLDRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.18
5 0.19
6 0.17
7 0.16
8 0.13
9 0.1
10 0.1
11 0.1
12 0.12
13 0.13
14 0.13
15 0.16
16 0.16
17 0.17
18 0.17
19 0.18
20 0.15
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.14
27 0.18
28 0.18
29 0.26
30 0.29
31 0.33
32 0.36
33 0.36
34 0.36
35 0.39
36 0.42
37 0.37
38 0.35
39 0.3
40 0.27
41 0.26
42 0.22
43 0.15
44 0.11
45 0.08
46 0.07
47 0.08
48 0.08
49 0.09
50 0.1
51 0.11
52 0.1
53 0.12
54 0.13
55 0.13
56 0.16
57 0.17
58 0.17
59 0.17
60 0.17
61 0.15
62 0.17
63 0.21
64 0.21
65 0.21
66 0.22
67 0.22
68 0.23
69 0.22
70 0.21
71 0.18
72 0.17
73 0.22
74 0.21
75 0.2
76 0.23
77 0.23
78 0.21
79 0.22
80 0.2
81 0.17
82 0.18
83 0.19
84 0.21
85 0.25
86 0.27
87 0.27
88 0.3
89 0.29
90 0.35
91 0.41
92 0.42
93 0.48
94 0.54
95 0.61
96 0.67
97 0.74
98 0.76
99 0.77
100 0.8
101 0.81