Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T0FJ92

Protein Details
Accession A0A2T0FJ92    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-41PEALKSIKETPKKPRKRPTKRQATTELEDHydrophilic
NLS Segment(s)
PositionSequence
19-33IKETPKKPRKRPTKR
Subcellular Location(s) nucl 12, mito_nucl 11.333, mito 9.5, cyto_nucl 9.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MSTTKVVILKAQPEALKSIKETPKKPRKRPTKRQATTELEDTPKVVGKAAPAVGGSVVRALDRSGVPCRKWTKSTLQIRSFTGVPFDVVSWKGETDPNVPEVKQEPALPENNVPSSELRSELVSEAPSEPASEPPEALPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.26
5 0.32
6 0.36
7 0.43
8 0.48
9 0.55
10 0.64
11 0.72
12 0.8
13 0.81
14 0.84
15 0.88
16 0.93
17 0.93
18 0.94
19 0.9
20 0.87
21 0.86
22 0.82
23 0.75
24 0.68
25 0.6
26 0.51
27 0.44
28 0.37
29 0.28
30 0.23
31 0.18
32 0.15
33 0.11
34 0.1
35 0.13
36 0.12
37 0.12
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.09
51 0.15
52 0.19
53 0.19
54 0.25
55 0.3
56 0.31
57 0.33
58 0.34
59 0.36
60 0.42
61 0.51
62 0.54
63 0.55
64 0.55
65 0.54
66 0.52
67 0.45
68 0.35
69 0.27
70 0.18
71 0.13
72 0.11
73 0.1
74 0.09
75 0.09
76 0.1
77 0.09
78 0.09
79 0.1
80 0.11
81 0.13
82 0.14
83 0.15
84 0.17
85 0.18
86 0.17
87 0.18
88 0.19
89 0.2
90 0.19
91 0.19
92 0.19
93 0.21
94 0.24
95 0.24
96 0.24
97 0.25
98 0.24
99 0.24
100 0.22
101 0.19
102 0.21
103 0.2
104 0.19
105 0.17
106 0.16
107 0.17
108 0.16
109 0.17
110 0.14
111 0.14
112 0.14
113 0.15
114 0.14
115 0.14
116 0.14
117 0.16
118 0.19
119 0.18
120 0.18