Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FK67

Protein Details
Accession A0A2T0FK67    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
209-230SPSPSPSPKPTGGKKKRKNKKKBasic
NLS Segment(s)
PositionSequence
215-230SPKPTGGKKKRKNKKK
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MFGRLASLFGGPKIQYIVVNYEKKEYRITFTAEDYTDNSVTVGSLRNMLAKQFKVPVTHLSLFVLKPQRKMSNNKASLEDYGLINGGTVVAVFKRTDEADPAPAPAPKATTAPLSPKQQLDAVAKAVDAELGEDRINAFIKSPPADAKARDKEYRLLSEIILQNTIKLDNVDVSGSQDLRLERKALINKFHEYHADIDAANEGRTAPSSPSPSPSPKPTGGKKKRKNKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.24
5 0.28
6 0.33
7 0.33
8 0.38
9 0.4
10 0.4
11 0.45
12 0.4
13 0.38
14 0.37
15 0.41
16 0.36
17 0.37
18 0.39
19 0.32
20 0.32
21 0.27
22 0.27
23 0.23
24 0.2
25 0.17
26 0.13
27 0.12
28 0.12
29 0.12
30 0.09
31 0.11
32 0.11
33 0.14
34 0.15
35 0.18
36 0.22
37 0.21
38 0.23
39 0.26
40 0.28
41 0.27
42 0.29
43 0.3
44 0.32
45 0.33
46 0.31
47 0.27
48 0.28
49 0.25
50 0.29
51 0.34
52 0.28
53 0.31
54 0.36
55 0.42
56 0.46
57 0.54
58 0.58
59 0.6
60 0.63
61 0.61
62 0.58
63 0.52
64 0.47
65 0.41
66 0.32
67 0.21
68 0.16
69 0.14
70 0.1
71 0.08
72 0.07
73 0.05
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.08
84 0.11
85 0.12
86 0.15
87 0.15
88 0.16
89 0.16
90 0.15
91 0.15
92 0.13
93 0.13
94 0.1
95 0.11
96 0.1
97 0.11
98 0.12
99 0.17
100 0.21
101 0.24
102 0.25
103 0.24
104 0.25
105 0.24
106 0.26
107 0.23
108 0.19
109 0.17
110 0.15
111 0.14
112 0.13
113 0.12
114 0.08
115 0.05
116 0.05
117 0.04
118 0.05
119 0.05
120 0.05
121 0.06
122 0.07
123 0.07
124 0.06
125 0.07
126 0.08
127 0.11
128 0.12
129 0.13
130 0.14
131 0.17
132 0.19
133 0.21
134 0.28
135 0.34
136 0.38
137 0.39
138 0.4
139 0.42
140 0.44
141 0.45
142 0.39
143 0.32
144 0.27
145 0.31
146 0.32
147 0.27
148 0.25
149 0.21
150 0.19
151 0.18
152 0.18
153 0.12
154 0.09
155 0.09
156 0.08
157 0.09
158 0.09
159 0.08
160 0.1
161 0.12
162 0.12
163 0.11
164 0.13
165 0.13
166 0.16
167 0.17
168 0.16
169 0.16
170 0.23
171 0.3
172 0.32
173 0.38
174 0.4
175 0.44
176 0.44
177 0.44
178 0.4
179 0.35
180 0.33
181 0.27
182 0.24
183 0.19
184 0.17
185 0.19
186 0.17
187 0.15
188 0.13
189 0.11
190 0.1
191 0.12
192 0.13
193 0.12
194 0.17
195 0.23
196 0.24
197 0.29
198 0.34
199 0.4
200 0.45
201 0.48
202 0.5
203 0.52
204 0.59
205 0.65
206 0.7
207 0.74
208 0.79
209 0.83
210 0.87