Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T0FF50

Protein Details
Accession A0A2T0FF50    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
105-129DPELPAKKRRSEGKTPPSKKQNKRRBasic
NLS Segment(s)
PositionSequence
110-129AKKRRSEGKTPPSKKQNKRR
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSVEATTKKTGKLSSKLLDMKFMKKPGDDNVAEPDEDVSEPVSGPDPGSWSIPGVRPKKTKLRTQLGFSDIQNTKFPVGRQLWKNGKCQDVRELEKEATPDVELDPELPAKKRRSEGKTPPSKKQNKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.57
4 0.54
5 0.57
6 0.52
7 0.51
8 0.5
9 0.5
10 0.44
11 0.38
12 0.41
13 0.37
14 0.42
15 0.37
16 0.33
17 0.34
18 0.33
19 0.32
20 0.29
21 0.24
22 0.16
23 0.15
24 0.13
25 0.08
26 0.07
27 0.07
28 0.07
29 0.08
30 0.07
31 0.07
32 0.07
33 0.08
34 0.09
35 0.1
36 0.1
37 0.1
38 0.11
39 0.15
40 0.23
41 0.24
42 0.3
43 0.32
44 0.37
45 0.46
46 0.5
47 0.53
48 0.54
49 0.61
50 0.57
51 0.58
52 0.57
53 0.5
54 0.47
55 0.39
56 0.38
57 0.3
58 0.29
59 0.26
60 0.22
61 0.2
62 0.2
63 0.2
64 0.2
65 0.23
66 0.28
67 0.3
68 0.39
69 0.47
70 0.49
71 0.56
72 0.53
73 0.56
74 0.51
75 0.5
76 0.49
77 0.47
78 0.48
79 0.44
80 0.44
81 0.38
82 0.37
83 0.35
84 0.28
85 0.21
86 0.17
87 0.14
88 0.11
89 0.11
90 0.1
91 0.09
92 0.1
93 0.12
94 0.14
95 0.17
96 0.24
97 0.27
98 0.34
99 0.4
100 0.49
101 0.54
102 0.62
103 0.7
104 0.74
105 0.8
106 0.81
107 0.84
108 0.85
109 0.88