Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FDT4

Protein Details
Accession A0A2T0FDT4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-61GGGVWYDRRERRRVRQEWKDKVAHLBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021056  Mt_import_IM_translocase_Tim54  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF11711  Tim54  
Amino Acid Sequences MARPEFSHPVLRMMGIPRLRVPSRNWSIFWALTAGIGGGVWYDRRERRRVRQEWKDKVAHLANAPISALELPRKVTVYVAPPPNDYLDVSLKHFRDYIKPILTAAAVDYELIEETQQGTIRYNVAESIRNERREAAGHPTSGYQKDDLDHKIDSRVARDLTGGVLCVGRGAYKEYLSGLQEGYMGPLEEPEFVKEEIERRKAAALAKAEEEKAKAEPAPEAKPAADNASEPAADEKPVDTIESASATEETAEKKAQDKEPRVPSWLRAEHYDEAKVDDLFFSAKLEPIGVFRHPHLLGFLNTPWRIVRYFNQRKLANEMGELTAAVVFNQTRPFTPQDIDLALSDEQDWPNSWKQNGRDANSEWMRELKVDPRIMPRLEVYDPKAPRPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.32
4 0.31
5 0.38
6 0.39
7 0.4
8 0.42
9 0.45
10 0.52
11 0.54
12 0.51
13 0.49
14 0.51
15 0.47
16 0.43
17 0.33
18 0.24
19 0.19
20 0.18
21 0.13
22 0.08
23 0.07
24 0.06
25 0.04
26 0.05
27 0.06
28 0.07
29 0.15
30 0.22
31 0.29
32 0.39
33 0.48
34 0.58
35 0.68
36 0.77
37 0.81
38 0.85
39 0.89
40 0.9
41 0.9
42 0.84
43 0.74
44 0.72
45 0.66
46 0.59
47 0.49
48 0.44
49 0.36
50 0.31
51 0.3
52 0.21
53 0.17
54 0.14
55 0.14
56 0.12
57 0.13
58 0.14
59 0.16
60 0.18
61 0.17
62 0.17
63 0.19
64 0.22
65 0.28
66 0.32
67 0.32
68 0.32
69 0.34
70 0.34
71 0.31
72 0.26
73 0.22
74 0.2
75 0.2
76 0.23
77 0.28
78 0.27
79 0.27
80 0.29
81 0.27
82 0.29
83 0.33
84 0.37
85 0.34
86 0.34
87 0.33
88 0.32
89 0.3
90 0.24
91 0.18
92 0.12
93 0.08
94 0.07
95 0.07
96 0.06
97 0.06
98 0.06
99 0.05
100 0.04
101 0.05
102 0.07
103 0.08
104 0.08
105 0.1
106 0.11
107 0.12
108 0.12
109 0.11
110 0.12
111 0.12
112 0.17
113 0.17
114 0.26
115 0.31
116 0.33
117 0.33
118 0.32
119 0.32
120 0.29
121 0.3
122 0.29
123 0.25
124 0.24
125 0.24
126 0.25
127 0.26
128 0.26
129 0.25
130 0.18
131 0.15
132 0.16
133 0.2
134 0.2
135 0.19
136 0.18
137 0.18
138 0.19
139 0.21
140 0.21
141 0.19
142 0.2
143 0.18
144 0.17
145 0.17
146 0.15
147 0.13
148 0.12
149 0.1
150 0.07
151 0.06
152 0.06
153 0.05
154 0.05
155 0.04
156 0.05
157 0.08
158 0.08
159 0.08
160 0.09
161 0.09
162 0.11
163 0.11
164 0.12
165 0.09
166 0.08
167 0.08
168 0.08
169 0.08
170 0.06
171 0.06
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.07
178 0.08
179 0.08
180 0.09
181 0.09
182 0.14
183 0.19
184 0.22
185 0.21
186 0.2
187 0.21
188 0.23
189 0.24
190 0.24
191 0.2
192 0.18
193 0.2
194 0.21
195 0.2
196 0.19
197 0.17
198 0.14
199 0.12
200 0.11
201 0.1
202 0.1
203 0.12
204 0.15
205 0.17
206 0.17
207 0.17
208 0.16
209 0.16
210 0.16
211 0.16
212 0.13
213 0.1
214 0.1
215 0.11
216 0.1
217 0.1
218 0.11
219 0.1
220 0.1
221 0.1
222 0.09
223 0.08
224 0.09
225 0.09
226 0.07
227 0.07
228 0.07
229 0.08
230 0.08
231 0.07
232 0.07
233 0.07
234 0.07
235 0.07
236 0.08
237 0.09
238 0.1
239 0.1
240 0.15
241 0.2
242 0.27
243 0.35
244 0.39
245 0.46
246 0.54
247 0.55
248 0.55
249 0.51
250 0.48
251 0.48
252 0.47
253 0.4
254 0.35
255 0.39
256 0.38
257 0.38
258 0.37
259 0.28
260 0.26
261 0.25
262 0.22
263 0.17
264 0.13
265 0.11
266 0.1
267 0.09
268 0.09
269 0.08
270 0.09
271 0.09
272 0.09
273 0.09
274 0.1
275 0.13
276 0.13
277 0.15
278 0.15
279 0.21
280 0.21
281 0.2
282 0.2
283 0.21
284 0.2
285 0.21
286 0.23
287 0.24
288 0.24
289 0.25
290 0.23
291 0.23
292 0.22
293 0.23
294 0.28
295 0.32
296 0.43
297 0.5
298 0.58
299 0.59
300 0.6
301 0.64
302 0.63
303 0.52
304 0.43
305 0.38
306 0.3
307 0.27
308 0.24
309 0.17
310 0.12
311 0.1
312 0.09
313 0.08
314 0.08
315 0.1
316 0.14
317 0.15
318 0.15
319 0.2
320 0.24
321 0.25
322 0.26
323 0.27
324 0.25
325 0.26
326 0.26
327 0.22
328 0.21
329 0.18
330 0.17
331 0.16
332 0.15
333 0.14
334 0.14
335 0.16
336 0.18
337 0.24
338 0.29
339 0.32
340 0.35
341 0.38
342 0.47
343 0.54
344 0.53
345 0.54
346 0.52
347 0.59
348 0.57
349 0.54
350 0.46
351 0.41
352 0.37
353 0.32
354 0.32
355 0.29
356 0.32
357 0.35
358 0.37
359 0.42
360 0.48
361 0.47
362 0.47
363 0.43
364 0.4
365 0.41
366 0.43
367 0.41
368 0.43
369 0.44