Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FBU6

Protein Details
Accession A0A2T0FBU6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAGEKRRRKKVRTNDASWSSSHydrophilic
NLS Segment(s)
PositionSequence
5-10KRRRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAGEKRRRKKVRTNDASWSSSSEDEMEIDNSKEIVQREDEISELSDSDFSQPSDEEPSHQEENPRTLIHKAPAAPASEDFNQFLLNMVTSEFGDDLEALRKANDFGPGSIELLISGLKQGVNIFSPEQRKMLLADK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.75
4 0.65
5 0.57
6 0.48
7 0.38
8 0.32
9 0.23
10 0.17
11 0.15
12 0.15
13 0.14
14 0.12
15 0.12
16 0.12
17 0.11
18 0.11
19 0.14
20 0.13
21 0.13
22 0.14
23 0.15
24 0.16
25 0.16
26 0.16
27 0.14
28 0.14
29 0.12
30 0.1
31 0.09
32 0.08
33 0.07
34 0.09
35 0.09
36 0.08
37 0.09
38 0.09
39 0.1
40 0.13
41 0.13
42 0.13
43 0.14
44 0.19
45 0.2
46 0.2
47 0.23
48 0.2
49 0.23
50 0.23
51 0.21
52 0.17
53 0.17
54 0.19
55 0.17
56 0.18
57 0.15
58 0.16
59 0.18
60 0.18
61 0.17
62 0.16
63 0.18
64 0.17
65 0.17
66 0.15
67 0.14
68 0.13
69 0.12
70 0.12
71 0.08
72 0.07
73 0.06
74 0.05
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.08
84 0.08
85 0.08
86 0.08
87 0.09
88 0.1
89 0.11
90 0.16
91 0.15
92 0.15
93 0.18
94 0.19
95 0.19
96 0.18
97 0.17
98 0.11
99 0.1
100 0.1
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.09
108 0.1
109 0.13
110 0.14
111 0.2
112 0.25
113 0.27
114 0.27
115 0.26
116 0.26