Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T0FCQ4

Protein Details
Accession A0A2T0FCQ4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
270-298AITIREDKPSKKRGGRRARRFKLQLTPTEHydrophilic
NLS Segment(s)
PositionSequence
277-291KPSKKRGGRRARRFK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, pero 3, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042239  Nop_C  
IPR002687  Nop_dom  
IPR036070  Nop_dom_sf  
IPR027105  Prp31  
IPR019175  Prp31_C  
Gene Ontology GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0000244  P:spliceosomal tri-snRNP complex assembly  
Pfam View protein in Pfam  
PF01798  Nop  
PF09785  Prp31_C  
PROSITE View protein in PROSITE  
PS51358  NOP  
Amino Acid Sequences MDIDELLEGLSDSGDDQTTQVVGPVAEDSPAELTVRIDEMLEPLGNQLKECYAPRFPELQALVPDLEEFCHIIKLLGPELTPNSQALEDIVGKQRAMVVQMSMAETPGRELTDSEWGQLQQILDNVFDLMQKREQAMQTLAQELSSHAPNLLGIVRLSTAVRLVAYRGGLAELASTPSANLISLGAPKASSVGGSMVRQGFIYNDPLVRGVPLHHKRQAVRMVSAKVVLAARMDLAKSSTDGSQGRLWRGQILDRLEKLSRAPISAQDRAITIREDKPSKKRGGRRARRFKLQLTPTELQRQRDRLAFGSSKGDYGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.08
6 0.08
7 0.09
8 0.09
9 0.08
10 0.09
11 0.1
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.1
18 0.1
19 0.09
20 0.09
21 0.1
22 0.11
23 0.1
24 0.09
25 0.09
26 0.1
27 0.11
28 0.11
29 0.1
30 0.11
31 0.16
32 0.16
33 0.16
34 0.15
35 0.15
36 0.18
37 0.21
38 0.24
39 0.23
40 0.26
41 0.3
42 0.32
43 0.31
44 0.35
45 0.34
46 0.32
47 0.29
48 0.28
49 0.25
50 0.21
51 0.21
52 0.14
53 0.13
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.1
61 0.12
62 0.13
63 0.13
64 0.12
65 0.13
66 0.16
67 0.18
68 0.16
69 0.14
70 0.14
71 0.13
72 0.13
73 0.11
74 0.11
75 0.1
76 0.12
77 0.17
78 0.16
79 0.16
80 0.16
81 0.17
82 0.15
83 0.16
84 0.14
85 0.09
86 0.09
87 0.1
88 0.11
89 0.1
90 0.1
91 0.08
92 0.07
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.08
99 0.17
100 0.17
101 0.16
102 0.17
103 0.16
104 0.17
105 0.18
106 0.16
107 0.09
108 0.1
109 0.1
110 0.09
111 0.09
112 0.08
113 0.07
114 0.08
115 0.09
116 0.09
117 0.1
118 0.11
119 0.12
120 0.15
121 0.15
122 0.16
123 0.17
124 0.18
125 0.17
126 0.18
127 0.17
128 0.14
129 0.13
130 0.12
131 0.12
132 0.1
133 0.09
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.05
146 0.05
147 0.04
148 0.05
149 0.05
150 0.05
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.05
162 0.05
163 0.04
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.05
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.05
178 0.05
179 0.06
180 0.08
181 0.08
182 0.11
183 0.11
184 0.11
185 0.11
186 0.11
187 0.1
188 0.1
189 0.13
190 0.11
191 0.11
192 0.11
193 0.12
194 0.12
195 0.11
196 0.1
197 0.09
198 0.19
199 0.24
200 0.3
201 0.34
202 0.39
203 0.4
204 0.47
205 0.52
206 0.45
207 0.44
208 0.44
209 0.41
210 0.37
211 0.37
212 0.29
213 0.23
214 0.2
215 0.16
216 0.11
217 0.09
218 0.09
219 0.09
220 0.09
221 0.07
222 0.08
223 0.08
224 0.08
225 0.1
226 0.1
227 0.14
228 0.14
229 0.17
230 0.21
231 0.24
232 0.27
233 0.28
234 0.28
235 0.27
236 0.28
237 0.28
238 0.29
239 0.32
240 0.34
241 0.33
242 0.36
243 0.33
244 0.33
245 0.31
246 0.32
247 0.27
248 0.23
249 0.23
250 0.27
251 0.33
252 0.36
253 0.36
254 0.3
255 0.3
256 0.3
257 0.3
258 0.25
259 0.22
260 0.24
261 0.31
262 0.37
263 0.43
264 0.5
265 0.57
266 0.64
267 0.7
268 0.73
269 0.77
270 0.81
271 0.86
272 0.88
273 0.91
274 0.9
275 0.91
276 0.88
277 0.84
278 0.83
279 0.8
280 0.77
281 0.74
282 0.7
283 0.65
284 0.69
285 0.66
286 0.62
287 0.62
288 0.6
289 0.56
290 0.56
291 0.55
292 0.47
293 0.51
294 0.47
295 0.42
296 0.43
297 0.39