Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T0FFY1

Protein Details
Accession A0A2T0FFY1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-100ALVMHRKRVERVRRREKRNKLLKERBasic
NLS Segment(s)
PositionSequence
26-100RRQKERLEKAALKAKEKELKEEKQAKKDEQIRRLKERRELKAERERYEKMALVMHRKRVERVRRREKRNKLLKER
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MVNVSGRTWKDSHKPGAPAVTTDWARRQKERLEKAALKAKEKELKEEKQAKKDEQIRRLKERRELKAERERYEKMALVMHRKRVERVRRREKRNKLLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.54
4 0.49
5 0.42
6 0.37
7 0.36
8 0.31
9 0.3
10 0.35
11 0.37
12 0.39
13 0.41
14 0.43
15 0.45
16 0.53
17 0.58
18 0.57
19 0.57
20 0.57
21 0.6
22 0.64
23 0.58
24 0.51
25 0.47
26 0.46
27 0.45
28 0.41
29 0.44
30 0.42
31 0.43
32 0.48
33 0.56
34 0.54
35 0.55
36 0.58
37 0.52
38 0.52
39 0.58
40 0.56
41 0.55
42 0.61
43 0.58
44 0.65
45 0.7
46 0.67
47 0.67
48 0.68
49 0.66
50 0.66
51 0.64
52 0.63
53 0.67
54 0.69
55 0.65
56 0.62
57 0.57
58 0.51
59 0.5
60 0.42
61 0.33
62 0.32
63 0.31
64 0.35
65 0.38
66 0.42
67 0.45
68 0.45
69 0.5
70 0.55
71 0.63
72 0.63
73 0.7
74 0.73
75 0.78
76 0.87
77 0.91
78 0.93
79 0.93
80 0.93