Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FK69

Protein Details
Accession A0A2T0FK69    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-97LKFYLMKDSKLRRRRSRGRKVAWSKQLEWHydrophilic
NLS Segment(s)
PositionSequence
78-89KLRRRRSRGRKV
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTGAAGEQEKEKIKPPETPLRRSARNEVPPSPGRRCVPHHHDAQPGPSSLKDAKKERAIHSGFYSAAELKFYLMKDSKLRRRRSRGRKVAWSKQLEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.52
4 0.56
5 0.6
6 0.62
7 0.63
8 0.67
9 0.65
10 0.65
11 0.64
12 0.66
13 0.65
14 0.59
15 0.59
16 0.58
17 0.59
18 0.55
19 0.52
20 0.44
21 0.44
22 0.46
23 0.48
24 0.5
25 0.5
26 0.52
27 0.49
28 0.53
29 0.49
30 0.47
31 0.4
32 0.33
33 0.28
34 0.21
35 0.2
36 0.19
37 0.23
38 0.24
39 0.27
40 0.31
41 0.37
42 0.42
43 0.42
44 0.48
45 0.44
46 0.41
47 0.39
48 0.36
49 0.29
50 0.25
51 0.23
52 0.15
53 0.14
54 0.12
55 0.1
56 0.09
57 0.11
58 0.11
59 0.15
60 0.15
61 0.19
62 0.26
63 0.36
64 0.46
65 0.52
66 0.62
67 0.68
68 0.77
69 0.85
70 0.88
71 0.9
72 0.9
73 0.91
74 0.92
75 0.92
76 0.91
77 0.9