Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FGI5

Protein Details
Accession A0A2T0FGI5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
128-149EPKQAKEEKKEKKVRTPKSKIVBasic
NLS Segment(s)
PositionSequence
116-146IKSKTGAEPQKAEPKQAKEEKKEKKVRTPKS
Subcellular Location(s) cyto 17, extr 4, E.R. 2, nucl 1, mito 1, pero 1, vacu 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011679  ERp29_C  
IPR036356  ERp29_C_sf  
IPR036249  Thioredoxin-like_sf  
IPR017937  Thioredoxin_CS  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016853  F:isomerase activity  
Pfam View protein in Pfam  
PF07749  ERp29  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS00194  THIOREDOXIN_1  
PS51352  THIOREDOXIN_2  
CDD cd02961  PDI_a_family  
Amino Acid Sequences MQLLKWLAVLPLSAAAVIEATDVDLDKLMSNGVPTILDIYASWCGHCKTFSPVFDEVAALYEHAKDKIQFVKIDGDIHRKAAKKHDVKFFPTIKFVDGDKQEDINSRDAKSLHKLIKSKTGAEPQKAEPKQAKEEKKEKKVRTPKSKIVSLTDDTFEDAVDDKDALVAFTTTWCGYCKRLKPVWDELAALYEQDDEIVVAEVDCTDSEPVANLMETFHVEGYPTIVYFPKDGSTPRPYTSGRDIKALVKFMKDEGISFRNADGQLDDHAGVVDALTEQAQSLIGASQEAYDGFIMAIETSGTPFADVYTRVAKKVFEKGASYVSEESARIEKLLATKLAPKKADKLRVKLNVLRTFVAKDTGKDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.06
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.07
13 0.07
14 0.07
15 0.08
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.1
23 0.09
24 0.09
25 0.09
26 0.11
27 0.16
28 0.16
29 0.16
30 0.17
31 0.19
32 0.2
33 0.21
34 0.2
35 0.22
36 0.29
37 0.31
38 0.33
39 0.34
40 0.34
41 0.33
42 0.32
43 0.24
44 0.18
45 0.16
46 0.11
47 0.1
48 0.11
49 0.12
50 0.12
51 0.14
52 0.13
53 0.18
54 0.24
55 0.28
56 0.26
57 0.27
58 0.32
59 0.32
60 0.36
61 0.35
62 0.37
63 0.34
64 0.36
65 0.39
66 0.35
67 0.37
68 0.42
69 0.49
70 0.49
71 0.56
72 0.62
73 0.63
74 0.65
75 0.7
76 0.67
77 0.59
78 0.55
79 0.48
80 0.39
81 0.36
82 0.32
83 0.3
84 0.27
85 0.28
86 0.25
87 0.25
88 0.24
89 0.27
90 0.29
91 0.28
92 0.28
93 0.25
94 0.26
95 0.26
96 0.28
97 0.29
98 0.35
99 0.33
100 0.37
101 0.4
102 0.4
103 0.49
104 0.48
105 0.46
106 0.44
107 0.48
108 0.48
109 0.47
110 0.49
111 0.43
112 0.51
113 0.48
114 0.47
115 0.44
116 0.43
117 0.49
118 0.53
119 0.57
120 0.55
121 0.65
122 0.7
123 0.74
124 0.79
125 0.75
126 0.77
127 0.8
128 0.81
129 0.83
130 0.82
131 0.79
132 0.76
133 0.76
134 0.67
135 0.62
136 0.56
137 0.47
138 0.4
139 0.33
140 0.26
141 0.22
142 0.2
143 0.15
144 0.1
145 0.08
146 0.07
147 0.06
148 0.06
149 0.05
150 0.06
151 0.06
152 0.05
153 0.05
154 0.04
155 0.04
156 0.04
157 0.06
158 0.05
159 0.06
160 0.07
161 0.08
162 0.12
163 0.18
164 0.23
165 0.3
166 0.33
167 0.37
168 0.41
169 0.47
170 0.47
171 0.42
172 0.38
173 0.3
174 0.28
175 0.24
176 0.18
177 0.11
178 0.07
179 0.06
180 0.05
181 0.04
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.05
199 0.04
200 0.04
201 0.05
202 0.06
203 0.06
204 0.05
205 0.05
206 0.05
207 0.05
208 0.07
209 0.06
210 0.06
211 0.06
212 0.07
213 0.08
214 0.08
215 0.09
216 0.08
217 0.1
218 0.11
219 0.16
220 0.22
221 0.24
222 0.25
223 0.29
224 0.3
225 0.33
226 0.41
227 0.43
228 0.37
229 0.37
230 0.38
231 0.38
232 0.4
233 0.4
234 0.32
235 0.26
236 0.25
237 0.23
238 0.25
239 0.2
240 0.18
241 0.19
242 0.2
243 0.19
244 0.19
245 0.19
246 0.19
247 0.19
248 0.19
249 0.14
250 0.13
251 0.13
252 0.14
253 0.14
254 0.1
255 0.1
256 0.09
257 0.08
258 0.07
259 0.05
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.06
275 0.06
276 0.06
277 0.06
278 0.06
279 0.05
280 0.06
281 0.05
282 0.05
283 0.05
284 0.04
285 0.05
286 0.05
287 0.06
288 0.06
289 0.06
290 0.06
291 0.06
292 0.08
293 0.09
294 0.12
295 0.21
296 0.22
297 0.23
298 0.25
299 0.26
300 0.29
301 0.37
302 0.39
303 0.34
304 0.35
305 0.37
306 0.41
307 0.4
308 0.39
309 0.31
310 0.27
311 0.25
312 0.22
313 0.22
314 0.2
315 0.19
316 0.16
317 0.16
318 0.16
319 0.18
320 0.22
321 0.21
322 0.2
323 0.29
324 0.36
325 0.43
326 0.45
327 0.44
328 0.49
329 0.57
330 0.66
331 0.65
332 0.66
333 0.69
334 0.74
335 0.78
336 0.75
337 0.76
338 0.73
339 0.68
340 0.62
341 0.55
342 0.49
343 0.43
344 0.44
345 0.36
346 0.3