Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FIJ3

Protein Details
Accession A0A2T0FIJ3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
150-172SPQLLSRRPAKAKANNKKTKPVAHydrophilic
NLS Segment(s)
PositionSequence
156-170RRPAKAKANNKKTKP
Subcellular Location(s) cyto 19, cyto_mito 13.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSTLQDPLAKPVWPQISTELEEQLVAVLCNLLAPLGSVKEPASIPDLFSRVTVGFNSTMAAVEEHFGDGPKLEAIIVCRGDLEPMIYSPFGLASSAGQIRLVPLSKGSALKLSTSSGREATAIGIRSGVDAVTKLIGDVGYAQTNWAFASPQLLSRRPAKAKANNKKTKPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.33
4 0.35
5 0.36
6 0.3
7 0.23
8 0.22
9 0.2
10 0.17
11 0.12
12 0.09
13 0.07
14 0.06
15 0.05
16 0.05
17 0.05
18 0.04
19 0.03
20 0.04
21 0.05
22 0.06
23 0.07
24 0.08
25 0.08
26 0.11
27 0.11
28 0.11
29 0.14
30 0.13
31 0.14
32 0.16
33 0.17
34 0.15
35 0.15
36 0.16
37 0.12
38 0.13
39 0.12
40 0.11
41 0.1
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.08
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.06
62 0.09
63 0.1
64 0.09
65 0.09
66 0.09
67 0.1
68 0.09
69 0.08
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.03
81 0.06
82 0.06
83 0.07
84 0.06
85 0.06
86 0.07
87 0.08
88 0.09
89 0.07
90 0.07
91 0.08
92 0.1
93 0.11
94 0.11
95 0.12
96 0.12
97 0.13
98 0.14
99 0.14
100 0.15
101 0.16
102 0.17
103 0.15
104 0.15
105 0.14
106 0.14
107 0.14
108 0.14
109 0.13
110 0.12
111 0.11
112 0.11
113 0.11
114 0.11
115 0.09
116 0.06
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.08
127 0.09
128 0.09
129 0.1
130 0.09
131 0.1
132 0.1
133 0.09
134 0.08
135 0.06
136 0.11
137 0.11
138 0.18
139 0.23
140 0.26
141 0.29
142 0.34
143 0.43
144 0.44
145 0.51
146 0.54
147 0.59
148 0.68
149 0.75
150 0.81
151 0.82
152 0.83