Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FKK8

Protein Details
Accession A0A2T0FKK8   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKKRASNGRNKKGRGHVTSBasic
90-109ENRRIRTPPVRVRYNRDNKRBasic
NLS Segment(s)
PositionSequence
3-15KKRASNGRNKKGR
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPKKRASNGRNKKGRGHVTSVRCSNCSRMVAKDKAIKRFTIRNMVESAAVRDISDASVYQEYVLPKLYVKVHYCVSCAVHNKIVRVRSRENRRIRTPPVRVRYNRDNKRVNPAAAAKAAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.72
4 0.7
5 0.68
6 0.72
7 0.71
8 0.63
9 0.56
10 0.52
11 0.48
12 0.44
13 0.41
14 0.35
15 0.35
16 0.4
17 0.42
18 0.46
19 0.49
20 0.49
21 0.54
22 0.53
23 0.49
24 0.45
25 0.49
26 0.48
27 0.5
28 0.45
29 0.39
30 0.39
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.11
54 0.12
55 0.15
56 0.17
57 0.19
58 0.21
59 0.22
60 0.22
61 0.22
62 0.22
63 0.22
64 0.24
65 0.24
66 0.27
67 0.28
68 0.3
69 0.33
70 0.37
71 0.38
72 0.4
73 0.46
74 0.5
75 0.59
76 0.66
77 0.72
78 0.75
79 0.77
80 0.79
81 0.8
82 0.8
83 0.79
84 0.8
85 0.78
86 0.8
87 0.77
88 0.77
89 0.79
90 0.8
91 0.8
92 0.79
93 0.8
94 0.74
95 0.79
96 0.77
97 0.68
98 0.64
99 0.59
100 0.55