Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R537

Protein Details
Accession C4R537    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
187-212EPVTNGKKVKKVKKLVKKKTSEDLKPBasic
269-301ETTTPSKKAAEKQDDKKQKKKKGFAAKLKKIFSHydrophilic
NLS Segment(s)
PositionSequence
193-205KKVKKVKKLVKKK
275-299KKAAEKQDDKKQKKKKGFAAKLKKI
Subcellular Location(s) cyto 14, cyto_nucl 12.833, nucl 9.5, mito_nucl 5.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
KEGG ppa:PAS_chr3_0627  -  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MASFTFTWPAGPNEVIVTGTFDNWQKTLPLVKKADQSFELTVPFPKDTPPVSYKYVVDGEWLVLGSAKSDGNDPSIRNNYFTAEDLDDNVSVAGGAIPESGGLKTTVMPSEEGIQKTLGEPGIVVPQNPGSIAAFKEVSTVDPKSLNKEEPASAPVANDVVIPEDPSAVAAFNEVSDVDPKTLNQEEPVTNGKKVKKVKKLVKKKTSEDLKPDTEPEGKAATEINPDRLVPSDEVAGDKIKDTPAEDVAAVDAKVPEVSEEPASKTAPETTTPSKKAAEKQDDKKQKKKKGFAAKLKKIFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.14
4 0.16
5 0.13
6 0.13
7 0.16
8 0.17
9 0.18
10 0.18
11 0.19
12 0.16
13 0.18
14 0.26
15 0.28
16 0.35
17 0.38
18 0.42
19 0.49
20 0.51
21 0.53
22 0.46
23 0.46
24 0.4
25 0.37
26 0.34
27 0.27
28 0.28
29 0.26
30 0.25
31 0.21
32 0.19
33 0.22
34 0.21
35 0.27
36 0.28
37 0.29
38 0.32
39 0.35
40 0.34
41 0.34
42 0.34
43 0.27
44 0.25
45 0.21
46 0.17
47 0.15
48 0.14
49 0.09
50 0.09
51 0.08
52 0.07
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.13
59 0.17
60 0.17
61 0.22
62 0.29
63 0.29
64 0.3
65 0.3
66 0.28
67 0.26
68 0.27
69 0.23
70 0.18
71 0.18
72 0.17
73 0.18
74 0.15
75 0.14
76 0.12
77 0.09
78 0.06
79 0.06
80 0.05
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.06
92 0.08
93 0.09
94 0.09
95 0.1
96 0.1
97 0.14
98 0.18
99 0.17
100 0.17
101 0.16
102 0.15
103 0.15
104 0.16
105 0.12
106 0.08
107 0.07
108 0.07
109 0.12
110 0.12
111 0.12
112 0.11
113 0.11
114 0.12
115 0.12
116 0.11
117 0.06
118 0.07
119 0.07
120 0.08
121 0.08
122 0.08
123 0.09
124 0.09
125 0.09
126 0.11
127 0.11
128 0.11
129 0.14
130 0.14
131 0.19
132 0.21
133 0.21
134 0.19
135 0.21
136 0.21
137 0.18
138 0.19
139 0.15
140 0.13
141 0.12
142 0.11
143 0.09
144 0.08
145 0.07
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.05
152 0.05
153 0.05
154 0.06
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.06
164 0.06
165 0.07
166 0.07
167 0.07
168 0.11
169 0.13
170 0.13
171 0.13
172 0.16
173 0.15
174 0.18
175 0.24
176 0.22
177 0.23
178 0.28
179 0.3
180 0.33
181 0.42
182 0.48
183 0.52
184 0.6
185 0.69
186 0.74
187 0.82
188 0.86
189 0.88
190 0.87
191 0.82
192 0.82
193 0.81
194 0.76
195 0.72
196 0.68
197 0.62
198 0.55
199 0.51
200 0.45
201 0.39
202 0.33
203 0.28
204 0.23
205 0.18
206 0.17
207 0.17
208 0.14
209 0.19
210 0.2
211 0.21
212 0.2
213 0.2
214 0.2
215 0.21
216 0.23
217 0.16
218 0.16
219 0.14
220 0.13
221 0.15
222 0.15
223 0.15
224 0.12
225 0.12
226 0.13
227 0.12
228 0.13
229 0.13
230 0.14
231 0.15
232 0.16
233 0.15
234 0.13
235 0.13
236 0.14
237 0.12
238 0.11
239 0.09
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.11
246 0.13
247 0.15
248 0.18
249 0.2
250 0.21
251 0.2
252 0.2
253 0.22
254 0.21
255 0.22
256 0.25
257 0.32
258 0.4
259 0.43
260 0.44
261 0.45
262 0.49
263 0.54
264 0.58
265 0.61
266 0.61
267 0.68
268 0.76
269 0.82
270 0.85
271 0.87
272 0.87
273 0.86
274 0.87
275 0.88
276 0.87
277 0.88
278 0.9
279 0.91
280 0.92
281 0.93