Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FJ29

Protein Details
Accession A0A2T0FJ29    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKSSKDKRDKYYRKAKEEGWRARSBasic
NLS Segment(s)
Subcellular Location(s) mito 20, pero 4, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028590  RNA_methyltr_E_TRM7  
IPR002877  RNA_MeTrfase_FtsJ_dom  
IPR015507  rRNA-MeTfrase_E  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0106339  F:tRNA (cytidine 32-2'-O)-methyltransferase activity  
GO:0002181  P:cytoplasmic translation  
GO:0002128  P:tRNA nucleoside ribose methylation  
Pfam View protein in Pfam  
PF01728  FtsJ  
Amino Acid Sequences MGKSSKDKRDKYYRKAKEEGWRARSAYKLLQLNEEFHFLEDFSRVVDLCAAPGSWSQVLSRQTQGRDRTIVSVDLQPMAPIPGVTTIQADITHPTTVDKILSEFGGHQADLVVSDGAPDVTGLHDLDEYVQAQLVFSALQLATAVLRTGGTFIAKIFRGRDIELMYAQLGRLFETVTCAKPRSSRGSSLEAFIVCQNYVPRAGWDPLELLKAKGSTQEYFEKLGLKEPLDSQLQAVEEVRVIAPFLACGDLSAYDSDATYVDTTEYSLDPVRSPVAPPYKTALDLKRQGVIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.82
4 0.81
5 0.81
6 0.81
7 0.77
8 0.72
9 0.66
10 0.64
11 0.6
12 0.53
13 0.48
14 0.45
15 0.45
16 0.4
17 0.46
18 0.44
19 0.43
20 0.41
21 0.38
22 0.31
23 0.25
24 0.25
25 0.17
26 0.16
27 0.13
28 0.12
29 0.09
30 0.09
31 0.09
32 0.08
33 0.11
34 0.1
35 0.09
36 0.1
37 0.09
38 0.1
39 0.1
40 0.13
41 0.12
42 0.12
43 0.12
44 0.17
45 0.2
46 0.22
47 0.27
48 0.28
49 0.31
50 0.38
51 0.42
52 0.41
53 0.41
54 0.39
55 0.37
56 0.34
57 0.31
58 0.26
59 0.25
60 0.22
61 0.2
62 0.19
63 0.15
64 0.14
65 0.13
66 0.11
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.09
73 0.08
74 0.09
75 0.09
76 0.09
77 0.09
78 0.11
79 0.11
80 0.1
81 0.1
82 0.11
83 0.11
84 0.11
85 0.09
86 0.08
87 0.09
88 0.09
89 0.08
90 0.08
91 0.1
92 0.1
93 0.1
94 0.09
95 0.08
96 0.08
97 0.08
98 0.08
99 0.05
100 0.04
101 0.04
102 0.05
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.05
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.05
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.03
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.07
141 0.08
142 0.09
143 0.1
144 0.12
145 0.13
146 0.14
147 0.16
148 0.15
149 0.15
150 0.14
151 0.14
152 0.12
153 0.1
154 0.09
155 0.09
156 0.07
157 0.07
158 0.06
159 0.06
160 0.06
161 0.1
162 0.12
163 0.12
164 0.15
165 0.15
166 0.16
167 0.2
168 0.25
169 0.29
170 0.31
171 0.35
172 0.37
173 0.42
174 0.42
175 0.39
176 0.36
177 0.28
178 0.25
179 0.2
180 0.17
181 0.11
182 0.11
183 0.11
184 0.1
185 0.11
186 0.11
187 0.11
188 0.14
189 0.15
190 0.14
191 0.15
192 0.15
193 0.15
194 0.18
195 0.17
196 0.14
197 0.14
198 0.15
199 0.14
200 0.18
201 0.2
202 0.18
203 0.21
204 0.26
205 0.26
206 0.28
207 0.29
208 0.28
209 0.25
210 0.29
211 0.28
212 0.23
213 0.22
214 0.21
215 0.24
216 0.22
217 0.22
218 0.17
219 0.17
220 0.17
221 0.16
222 0.15
223 0.12
224 0.1
225 0.11
226 0.1
227 0.08
228 0.08
229 0.07
230 0.07
231 0.06
232 0.07
233 0.07
234 0.06
235 0.06
236 0.07
237 0.08
238 0.09
239 0.09
240 0.09
241 0.09
242 0.09
243 0.09
244 0.08
245 0.09
246 0.08
247 0.08
248 0.08
249 0.08
250 0.08
251 0.1
252 0.1
253 0.1
254 0.13
255 0.14
256 0.14
257 0.16
258 0.18
259 0.17
260 0.18
261 0.25
262 0.31
263 0.31
264 0.33
265 0.37
266 0.37
267 0.4
268 0.45
269 0.43
270 0.43
271 0.5
272 0.5
273 0.5