Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T0FCU4

Protein Details
Accession A0A2T0FCU4   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
131-159YSAAPSPADRKDRKKRKEVGPLPAEKRRKBasic
NLS Segment(s)
PositionSequence
140-160RKDRKKRKEVGPLPAEKRRKL
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF08633  Rox3  
Amino Acid Sequences MGSYLAPQVKYQRGEPSGKDNLIELYHLTEIANSVARQDPVTGAKRKLRKSYKNHIADLPGKHTIPTRGETVWSLVELAHMPAPTRVDMPDLNLGLLNNLRFEKAPATGVPGFDPKLLATATPQNGDIYAYSAAPSPADRKDRKKRKEVGPLPAEKRRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.48
4 0.48
5 0.46
6 0.43
7 0.35
8 0.32
9 0.28
10 0.26
11 0.18
12 0.13
13 0.13
14 0.13
15 0.12
16 0.1
17 0.1
18 0.1
19 0.12
20 0.09
21 0.11
22 0.13
23 0.14
24 0.14
25 0.14
26 0.15
27 0.19
28 0.25
29 0.28
30 0.3
31 0.37
32 0.44
33 0.49
34 0.57
35 0.62
36 0.65
37 0.69
38 0.76
39 0.79
40 0.78
41 0.75
42 0.67
43 0.62
44 0.58
45 0.51
46 0.44
47 0.37
48 0.3
49 0.28
50 0.27
51 0.25
52 0.22
53 0.22
54 0.2
55 0.17
56 0.18
57 0.18
58 0.18
59 0.14
60 0.12
61 0.1
62 0.07
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.11
77 0.14
78 0.13
79 0.13
80 0.12
81 0.12
82 0.1
83 0.12
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.09
90 0.1
91 0.1
92 0.12
93 0.11
94 0.16
95 0.17
96 0.17
97 0.18
98 0.18
99 0.18
100 0.16
101 0.17
102 0.11
103 0.12
104 0.11
105 0.1
106 0.1
107 0.16
108 0.18
109 0.19
110 0.19
111 0.17
112 0.18
113 0.18
114 0.16
115 0.12
116 0.1
117 0.09
118 0.09
119 0.1
120 0.1
121 0.1
122 0.11
123 0.12
124 0.18
125 0.27
126 0.34
127 0.44
128 0.55
129 0.66
130 0.74
131 0.8
132 0.83
133 0.85
134 0.89
135 0.87
136 0.86
137 0.85
138 0.86
139 0.83
140 0.83