Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7RUL9

Protein Details
Accession J7RUL9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
142-185VPPPQEKPQQPKPQPQPQPQPQPQPQPQPQPEPKPQKQHHHSGAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_nucl 10.5, nucl 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Pfam View protein in Pfam  
PF14604  SH3_9  
PROSITE View protein in PROSITE  
PS50002  SH3  
Amino Acid Sequences MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVDDAMFQDIPPSSFSTQQYVPPYVPPPQEKPQQPKPQPQPQPQPQPQPQPQPQPEPKPQKQHHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGIANKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.22
5 0.2
6 0.16
7 0.16
8 0.15
9 0.13
10 0.13
11 0.15
12 0.14
13 0.14
14 0.14
15 0.16
16 0.2
17 0.25
18 0.26
19 0.32
20 0.31
21 0.38
22 0.4
23 0.4
24 0.36
25 0.36
26 0.42
27 0.39
28 0.39
29 0.38
30 0.34
31 0.32
32 0.31
33 0.28
34 0.21
35 0.19
36 0.19
37 0.15
38 0.24
39 0.25
40 0.26
41 0.29
42 0.28
43 0.29
44 0.31
45 0.3
46 0.23
47 0.28
48 0.26
49 0.24
50 0.22
51 0.21
52 0.17
53 0.18
54 0.21
55 0.21
56 0.24
57 0.27
58 0.35
59 0.34
60 0.38
61 0.39
62 0.35
63 0.3
64 0.27
65 0.24
66 0.19
67 0.18
68 0.13
69 0.1
70 0.08
71 0.08
72 0.08
73 0.09
74 0.07
75 0.07
76 0.07
77 0.09
78 0.09
79 0.1
80 0.14
81 0.17
82 0.22
83 0.28
84 0.32
85 0.34
86 0.37
87 0.43
88 0.39
89 0.4
90 0.4
91 0.42
92 0.39
93 0.37
94 0.37
95 0.31
96 0.3
97 0.27
98 0.21
99 0.15
100 0.15
101 0.13
102 0.11
103 0.09
104 0.11
105 0.11
106 0.11
107 0.09
108 0.09
109 0.09
110 0.08
111 0.08
112 0.06
113 0.06
114 0.07
115 0.08
116 0.1
117 0.1
118 0.14
119 0.15
120 0.18
121 0.19
122 0.23
123 0.25
124 0.24
125 0.24
126 0.22
127 0.24
128 0.25
129 0.29
130 0.28
131 0.31
132 0.36
133 0.43
134 0.48
135 0.54
136 0.59
137 0.66
138 0.68
139 0.72
140 0.75
141 0.78
142 0.8
143 0.81
144 0.82
145 0.8
146 0.85
147 0.81
148 0.82
149 0.79
150 0.79
151 0.77
152 0.76
153 0.73
154 0.73
155 0.71
156 0.71
157 0.73
158 0.71
159 0.75
160 0.75
161 0.76
162 0.76
163 0.79
164 0.8
165 0.78
166 0.8
167 0.77
168 0.76
169 0.75
170 0.71
171 0.71
172 0.69
173 0.65
174 0.59
175 0.56
176 0.5
177 0.45
178 0.38
179 0.34
180 0.32
181 0.31
182 0.27
183 0.23
184 0.2
185 0.2
186 0.2
187 0.19
188 0.13
189 0.11
190 0.11
191 0.11
192 0.12
193 0.11
194 0.11
195 0.1
196 0.1
197 0.13