Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7RFE7

Protein Details
Accession J7RFE7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRMSAPQKRRQRSRLRSVDSVHydrophilic
103-123DKKVRGYRKGIHKVPKWTKVSBasic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGPFRASSPAMGGLLWKIPWRMSAPQKRRQRSRLRSVDSVIEQVTLGLHVARCEEKGIGYEEAVAMPEKFQPRSKLLRLLNKPAYFPKESEMEPKNKYTVFDKKVRGYRKGIHKVPKWTKVSAQRTNRYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.14
5 0.13
6 0.13
7 0.16
8 0.19
9 0.26
10 0.35
11 0.45
12 0.51
13 0.6
14 0.69
15 0.76
16 0.82
17 0.84
18 0.84
19 0.83
20 0.86
21 0.87
22 0.84
23 0.78
24 0.71
25 0.66
26 0.56
27 0.48
28 0.37
29 0.27
30 0.2
31 0.16
32 0.13
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.06
39 0.07
40 0.07
41 0.08
42 0.08
43 0.07
44 0.09
45 0.11
46 0.1
47 0.1
48 0.09
49 0.09
50 0.08
51 0.09
52 0.07
53 0.05
54 0.05
55 0.08
56 0.09
57 0.11
58 0.14
59 0.18
60 0.22
61 0.29
62 0.31
63 0.36
64 0.4
65 0.48
66 0.5
67 0.55
68 0.58
69 0.53
70 0.52
71 0.48
72 0.48
73 0.4
74 0.36
75 0.3
76 0.25
77 0.25
78 0.31
79 0.32
80 0.33
81 0.34
82 0.35
83 0.36
84 0.33
85 0.34
86 0.34
87 0.38
88 0.38
89 0.43
90 0.48
91 0.53
92 0.6
93 0.65
94 0.64
95 0.61
96 0.63
97 0.67
98 0.71
99 0.7
100 0.72
101 0.73
102 0.78
103 0.81
104 0.82
105 0.76
106 0.69
107 0.7
108 0.71
109 0.74
110 0.73
111 0.73