Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J7S4P5

Protein Details
Accession J7S4P5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-100IQLDSVLRKRRKKMKKHKLRKRRKREKAERLKLSQGRBasic
NLS Segment(s)
PositionSequence
71-100RKRRKKMKKHKLRKRRKREKAERLKLSQGR
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLSVLRHCARAAATPLSAAARGYGLRRLVSLSSLVCKTHPPSGVLTWPTVGLPQDGPTILGEVIQLDSVLRKRRKKMKKHKLRKRRKREKAERLKLSQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.21
4 0.2
5 0.15
6 0.11
7 0.09
8 0.1
9 0.11
10 0.14
11 0.15
12 0.15
13 0.15
14 0.16
15 0.15
16 0.15
17 0.16
18 0.12
19 0.14
20 0.15
21 0.15
22 0.13
23 0.16
24 0.17
25 0.2
26 0.21
27 0.19
28 0.2
29 0.22
30 0.25
31 0.24
32 0.22
33 0.17
34 0.15
35 0.14
36 0.12
37 0.1
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.08
44 0.07
45 0.08
46 0.07
47 0.07
48 0.05
49 0.05
50 0.06
51 0.05
52 0.05
53 0.04
54 0.06
55 0.1
56 0.19
57 0.27
58 0.33
59 0.42
60 0.53
61 0.63
62 0.72
63 0.8
64 0.82
65 0.87
66 0.92
67 0.94
68 0.95
69 0.97
70 0.97
71 0.97
72 0.97
73 0.96
74 0.96
75 0.97
76 0.97
77 0.97
78 0.96
79 0.95
80 0.9