Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7RJX8

Protein Details
Accession J7RJX8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
234-254LEKIRQVKKRERDQTEQSQLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, mito 7, cyto 5.5, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046962  Atg3  
IPR007135  Atg3/Atg10  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0019776  F:Atg8 ligase activity  
GO:0006914  P:autophagy  
Pfam View protein in Pfam  
PF03987  Autophagy_act_C  
Amino Acid Sequences MLRSKISSWREYLTPVTHKSTFFSSGEITPEEFTLSGDYLTHMFPTWRWNGNEESLKNASVRDFLPEGKQFLVTRKVPSSVRANAFFEAGAMGPSAFIFDEEELSKSTADTDPSPLANPEASQDIDEAIGELEISESIGSRDGDDDEIIIKSDENKRYYDLYITYSTSYRVPKMYIVGYNAQGSPLTADEMFEDITKEYRHKTATIEKLPFYKGTVISVSIHPCKHANVMKVLLEKIRQVKKRERDQTEQSQLQSTESMEDDWEDLQDDINDTLRVDQYLVVFLKFITGIIPSIEHDYTMEGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.45
4 0.44
5 0.43
6 0.42
7 0.41
8 0.39
9 0.33
10 0.3
11 0.27
12 0.25
13 0.28
14 0.26
15 0.23
16 0.19
17 0.19
18 0.17
19 0.14
20 0.13
21 0.12
22 0.11
23 0.1
24 0.09
25 0.1
26 0.1
27 0.11
28 0.11
29 0.09
30 0.09
31 0.1
32 0.17
33 0.21
34 0.27
35 0.28
36 0.3
37 0.33
38 0.4
39 0.47
40 0.41
41 0.41
42 0.37
43 0.36
44 0.34
45 0.31
46 0.25
47 0.19
48 0.19
49 0.17
50 0.17
51 0.17
52 0.23
53 0.24
54 0.26
55 0.24
56 0.27
57 0.23
58 0.26
59 0.33
60 0.29
61 0.31
62 0.31
63 0.35
64 0.32
65 0.36
66 0.38
67 0.38
68 0.4
69 0.39
70 0.39
71 0.35
72 0.35
73 0.3
74 0.23
75 0.16
76 0.11
77 0.08
78 0.06
79 0.05
80 0.04
81 0.04
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.07
88 0.08
89 0.09
90 0.09
91 0.1
92 0.1
93 0.09
94 0.11
95 0.1
96 0.11
97 0.11
98 0.13
99 0.14
100 0.15
101 0.15
102 0.14
103 0.13
104 0.12
105 0.11
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.07
114 0.06
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.02
123 0.03
124 0.03
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.05
138 0.08
139 0.14
140 0.19
141 0.2
142 0.2
143 0.22
144 0.24
145 0.24
146 0.23
147 0.18
148 0.17
149 0.17
150 0.17
151 0.17
152 0.15
153 0.15
154 0.17
155 0.17
156 0.15
157 0.14
158 0.14
159 0.14
160 0.16
161 0.17
162 0.16
163 0.17
164 0.18
165 0.18
166 0.18
167 0.17
168 0.15
169 0.13
170 0.11
171 0.09
172 0.07
173 0.07
174 0.06
175 0.06
176 0.06
177 0.07
178 0.08
179 0.07
180 0.07
181 0.06
182 0.09
183 0.09
184 0.11
185 0.12
186 0.15
187 0.17
188 0.17
189 0.21
190 0.29
191 0.37
192 0.42
193 0.43
194 0.42
195 0.43
196 0.43
197 0.39
198 0.32
199 0.27
200 0.2
201 0.19
202 0.19
203 0.17
204 0.18
205 0.2
206 0.23
207 0.23
208 0.23
209 0.23
210 0.23
211 0.22
212 0.28
213 0.3
214 0.28
215 0.28
216 0.31
217 0.33
218 0.35
219 0.35
220 0.3
221 0.27
222 0.28
223 0.33
224 0.38
225 0.41
226 0.46
227 0.55
228 0.62
229 0.71
230 0.77
231 0.76
232 0.75
233 0.78
234 0.81
235 0.81
236 0.75
237 0.66
238 0.6
239 0.53
240 0.46
241 0.38
242 0.28
243 0.21
244 0.17
245 0.16
246 0.11
247 0.12
248 0.11
249 0.1
250 0.1
251 0.09
252 0.09
253 0.09
254 0.09
255 0.1
256 0.1
257 0.12
258 0.12
259 0.11
260 0.13
261 0.13
262 0.13
263 0.13
264 0.13
265 0.12
266 0.18
267 0.18
268 0.16
269 0.15
270 0.14
271 0.15
272 0.13
273 0.12
274 0.08
275 0.08
276 0.09
277 0.09
278 0.11
279 0.1
280 0.15
281 0.15
282 0.15
283 0.14