Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AN78

Protein Details
Accession G3AN78    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-28VSLKLMCSRKWSRSRSRIKLDYDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
KEGG spaa:SPAPADRAFT_61024  -  
Amino Acid Sequences MCYKVVSLKLMCSRKWSRSRSRIKLDYDYQLQLFLSRIYFPVSLVAISCTVSDVTNMTVATIDSANPTRDIQICTYISEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.63
4 0.64
5 0.7
6 0.8
7 0.81
8 0.85
9 0.82
10 0.78
11 0.77
12 0.7
13 0.65
14 0.58
15 0.5
16 0.4
17 0.34
18 0.28
19 0.21
20 0.17
21 0.12
22 0.09
23 0.07
24 0.07
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.06
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.07
50 0.09
51 0.12
52 0.13
53 0.14
54 0.15
55 0.17
56 0.2
57 0.23
58 0.22
59 0.26
60 0.26