Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J7RVP8

Protein Details
Accession J7RVP8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-39AAMAGGKKSKKKWSKKSMKDKAAHAHydrophilic
NLS Segment(s)
PositionSequence
12-35KAAAAMAGGKKSKKKWSKKSMKDK
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKSMKDKAAHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARVALKHLEAEGIIKPVSKHSKQAIYTRAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.17
4 0.14
5 0.15
6 0.17
7 0.2
8 0.25
9 0.29
10 0.39
11 0.48
12 0.57
13 0.65
14 0.73
15 0.81
16 0.86
17 0.92
18 0.93
19 0.92
20 0.86
21 0.79
22 0.76
23 0.67
24 0.56
25 0.45
26 0.36
27 0.28
28 0.25
29 0.21
30 0.13
31 0.11
32 0.11
33 0.13
34 0.14
35 0.12
36 0.12
37 0.15
38 0.16
39 0.22
40 0.27
41 0.27
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.11
64 0.11
65 0.12
66 0.14
67 0.12
68 0.12
69 0.11
70 0.1
71 0.08
72 0.1
73 0.11
74 0.11
75 0.11
76 0.11
77 0.12
78 0.19
79 0.28
80 0.28
81 0.34
82 0.39
83 0.47
84 0.51
85 0.58
86 0.57
87 0.54