Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7S9A8

Protein Details
Accession J7S9A8   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
193-221DNLYHDGTAKKRKKMKRRRGANEATLSSKHydrophilic
NLS Segment(s)
PositionSequence
201-216AKKRKKMKRRRGANEA
Subcellular Location(s) nucl 24.5, cyto_nucl 13.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGNDGGSISKVQNLKLSLDPEVKRSKIETNEFNSVSRWKVCRVTNTPLRLPIVSDYKGYLYNKESILEWMLASPSKGCYSTSQIKQLSHIKRIHDVVELANLDEVKTASGIFLRCNFGDDILGDDMKSTFVYVVPCGDVLPRITTELSSSNDKSMKCPQCMTPCSKENIIPINPQATQDIQRLKDRYQRLSRDNLYHDGTAKKRKKMKRRRGANEATLSSKKTKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.3
4 0.31
5 0.37
6 0.37
7 0.38
8 0.44
9 0.41
10 0.39
11 0.39
12 0.41
13 0.42
14 0.48
15 0.49
16 0.48
17 0.55
18 0.54
19 0.52
20 0.47
21 0.41
22 0.37
23 0.35
24 0.31
25 0.28
26 0.33
27 0.36
28 0.43
29 0.47
30 0.53
31 0.55
32 0.59
33 0.58
34 0.56
35 0.54
36 0.44
37 0.4
38 0.35
39 0.33
40 0.28
41 0.25
42 0.22
43 0.21
44 0.26
45 0.25
46 0.24
47 0.21
48 0.23
49 0.23
50 0.23
51 0.22
52 0.18
53 0.19
54 0.17
55 0.14
56 0.1
57 0.11
58 0.1
59 0.1
60 0.09
61 0.08
62 0.09
63 0.1
64 0.1
65 0.12
66 0.19
67 0.27
68 0.3
69 0.36
70 0.38
71 0.37
72 0.41
73 0.48
74 0.45
75 0.45
76 0.45
77 0.39
78 0.4
79 0.41
80 0.37
81 0.3
82 0.26
83 0.19
84 0.19
85 0.17
86 0.13
87 0.12
88 0.1
89 0.09
90 0.08
91 0.08
92 0.05
93 0.04
94 0.04
95 0.04
96 0.06
97 0.06
98 0.07
99 0.09
100 0.11
101 0.1
102 0.12
103 0.12
104 0.11
105 0.11
106 0.1
107 0.1
108 0.09
109 0.09
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.05
116 0.04
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.08
128 0.08
129 0.09
130 0.09
131 0.09
132 0.11
133 0.13
134 0.15
135 0.18
136 0.18
137 0.21
138 0.24
139 0.24
140 0.26
141 0.33
142 0.37
143 0.35
144 0.37
145 0.4
146 0.45
147 0.5
148 0.53
149 0.5
150 0.48
151 0.49
152 0.49
153 0.45
154 0.4
155 0.42
156 0.38
157 0.34
158 0.32
159 0.31
160 0.3
161 0.29
162 0.26
163 0.21
164 0.23
165 0.25
166 0.29
167 0.29
168 0.36
169 0.38
170 0.4
171 0.45
172 0.48
173 0.52
174 0.55
175 0.6
176 0.59
177 0.65
178 0.67
179 0.66
180 0.64
181 0.6
182 0.54
183 0.48
184 0.46
185 0.44
186 0.44
187 0.48
188 0.51
189 0.55
190 0.61
191 0.69
192 0.77
193 0.81
194 0.86
195 0.86
196 0.9
197 0.91
198 0.92
199 0.92
200 0.9
201 0.88
202 0.8
203 0.77
204 0.69
205 0.62