Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S7PS91

Protein Details
Accession A0A2S7PS91    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
195-238KTNGTAEKKKPGKPKANNTSEKKAAPKKEKKVPAVGRSQRKTRSHydrophilic
NLS Segment(s)
PositionSequence
188-236KKQKTNGKTNGTAEKKKPGKPKANNTSEKKAAPKKEKKVPAVGRSQRKT
Subcellular Location(s) cyto_nucl 13.833, nucl 13.5, cyto 12, mito_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MNGSIRVSWQWGGANPDGTVAEVKAGEVSVTSKKGNEIKKQGNENDPAVAIERSGNDVVKKASELTVESKGEAEGSTGEEKNDTNGESGETEENKEISQENKPEANDTEEKADVEMKDRDEKTEQEVVENGDAKDEEKVASKDNTNGQQEESNEKENGSEAEAQPGDKRKAGEKVASDEDVEDDKDAKKQKTNGKTNGTAEKKKPGKPKANNTSEKKAAPKKEKKVPAVGRSQRKTRSQGTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.24
4 0.22
5 0.2
6 0.18
7 0.12
8 0.11
9 0.09
10 0.1
11 0.09
12 0.08
13 0.07
14 0.07
15 0.1
16 0.12
17 0.15
18 0.16
19 0.16
20 0.21
21 0.29
22 0.36
23 0.42
24 0.48
25 0.55
26 0.62
27 0.69
28 0.7
29 0.69
30 0.66
31 0.58
32 0.5
33 0.41
34 0.33
35 0.27
36 0.21
37 0.15
38 0.12
39 0.11
40 0.13
41 0.14
42 0.14
43 0.13
44 0.15
45 0.15
46 0.15
47 0.15
48 0.13
49 0.13
50 0.13
51 0.14
52 0.16
53 0.21
54 0.2
55 0.2
56 0.19
57 0.18
58 0.17
59 0.15
60 0.11
61 0.06
62 0.08
63 0.11
64 0.11
65 0.11
66 0.12
67 0.12
68 0.13
69 0.13
70 0.11
71 0.09
72 0.09
73 0.1
74 0.09
75 0.11
76 0.12
77 0.11
78 0.12
79 0.12
80 0.12
81 0.11
82 0.11
83 0.11
84 0.1
85 0.15
86 0.16
87 0.17
88 0.2
89 0.2
90 0.21
91 0.21
92 0.24
93 0.21
94 0.2
95 0.2
96 0.17
97 0.17
98 0.16
99 0.17
100 0.12
101 0.13
102 0.14
103 0.13
104 0.19
105 0.19
106 0.21
107 0.21
108 0.21
109 0.23
110 0.25
111 0.24
112 0.18
113 0.19
114 0.18
115 0.18
116 0.19
117 0.14
118 0.1
119 0.1
120 0.09
121 0.09
122 0.08
123 0.07
124 0.09
125 0.1
126 0.12
127 0.14
128 0.14
129 0.17
130 0.21
131 0.27
132 0.26
133 0.26
134 0.25
135 0.26
136 0.27
137 0.29
138 0.27
139 0.24
140 0.22
141 0.21
142 0.2
143 0.17
144 0.17
145 0.14
146 0.15
147 0.11
148 0.16
149 0.16
150 0.16
151 0.19
152 0.24
153 0.24
154 0.22
155 0.24
156 0.23
157 0.3
158 0.32
159 0.34
160 0.31
161 0.35
162 0.36
163 0.36
164 0.32
165 0.26
166 0.24
167 0.2
168 0.18
169 0.13
170 0.11
171 0.11
172 0.16
173 0.22
174 0.23
175 0.28
176 0.35
177 0.44
178 0.53
179 0.62
180 0.66
181 0.68
182 0.71
183 0.7
184 0.73
185 0.72
186 0.69
187 0.62
188 0.64
189 0.63
190 0.64
191 0.69
192 0.69
193 0.72
194 0.75
195 0.83
196 0.83
197 0.87
198 0.89
199 0.87
200 0.86
201 0.81
202 0.75
203 0.73
204 0.71
205 0.71
206 0.72
207 0.75
208 0.76
209 0.8
210 0.85
211 0.82
212 0.84
213 0.83
214 0.8
215 0.81
216 0.81
217 0.81
218 0.79
219 0.82
220 0.79
221 0.78
222 0.77