Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S7PV79

Protein Details
Accession A0A2S7PV79   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPSKKRRPPKKWSLYPSLHDTHydrophilic
NLS Segment(s)
PositionSequence
4-11KKRRPPKK
Subcellular Location(s) mito 15.5, mito_nucl 12.666, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Amino Acid Sequences MPSKKRRPPKKWSLYPSLHDTIAPLLEESHLNFSFHPTDDETTCIKYYDTNIMGRFICHNSACSAGGWASKRIAITIRLYQGKKYNGKPHDTELCEGCRAGRCSGFGELGEEWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.77
4 0.69
5 0.58
6 0.47
7 0.39
8 0.31
9 0.25
10 0.19
11 0.12
12 0.09
13 0.09
14 0.1
15 0.1
16 0.14
17 0.14
18 0.14
19 0.14
20 0.17
21 0.18
22 0.18
23 0.19
24 0.15
25 0.16
26 0.17
27 0.19
28 0.17
29 0.18
30 0.17
31 0.16
32 0.14
33 0.12
34 0.14
35 0.17
36 0.18
37 0.18
38 0.18
39 0.2
40 0.2
41 0.19
42 0.19
43 0.14
44 0.15
45 0.12
46 0.12
47 0.11
48 0.12
49 0.12
50 0.11
51 0.1
52 0.09
53 0.12
54 0.12
55 0.13
56 0.12
57 0.12
58 0.12
59 0.12
60 0.14
61 0.14
62 0.16
63 0.19
64 0.24
65 0.29
66 0.3
67 0.33
68 0.38
69 0.43
70 0.46
71 0.49
72 0.53
73 0.53
74 0.58
75 0.58
76 0.58
77 0.59
78 0.55
79 0.5
80 0.44
81 0.42
82 0.37
83 0.34
84 0.3
85 0.28
86 0.28
87 0.28
88 0.27
89 0.25
90 0.27
91 0.3
92 0.29
93 0.22
94 0.23