Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S7PDY4

Protein Details
Accession A0A2S7PDY4   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MHFARKRRFRKRISSDGFEAHydrophilic
NLS Segment(s)
PositionSequence
6-11KRRFRK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Gene Ontology GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MHFARKRRFRKRISSDGFEADEAEYSEDQDAEGEADDGSYFGGHMQQNGIDGDLDADLAADLEAAMEAEIEFETAATPMSGVAATPSMMQGGTPAAAEEDEDSGDESIEDGESDEDNNGADDIDDDEKARLAHLQEAKEDIADLERQIAGVHAQLVVQNNPILRKRLEDNARKLKAELELKKSAIGEAEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.78
3 0.72
4 0.65
5 0.53
6 0.45
7 0.34
8 0.26
9 0.19
10 0.17
11 0.12
12 0.11
13 0.11
14 0.1
15 0.1
16 0.09
17 0.08
18 0.06
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.09
30 0.09
31 0.09
32 0.1
33 0.1
34 0.12
35 0.12
36 0.12
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.04
99 0.04
100 0.05
101 0.05
102 0.04
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.06
110 0.07
111 0.07
112 0.07
113 0.08
114 0.09
115 0.09
116 0.08
117 0.09
118 0.08
119 0.15
120 0.19
121 0.2
122 0.2
123 0.22
124 0.22
125 0.2
126 0.19
127 0.13
128 0.1
129 0.1
130 0.09
131 0.09
132 0.08
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.08
139 0.06
140 0.06
141 0.09
142 0.11
143 0.12
144 0.13
145 0.13
146 0.14
147 0.19
148 0.22
149 0.24
150 0.23
151 0.26
152 0.29
153 0.37
154 0.46
155 0.5
156 0.57
157 0.64
158 0.68
159 0.65
160 0.62
161 0.55
162 0.54
163 0.54
164 0.51
165 0.48
166 0.49
167 0.48
168 0.5
169 0.47
170 0.4
171 0.32