Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S7QMU0

Protein Details
Accession A0A2S7QMU0    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SFPARHSSPPKRPKLSLQIKTHydrophilic
285-315GLETPKGKAGRRKRDKDRKRKWRWTIGVGDGBasic
NLS Segment(s)
PositionSequence
289-307PKGKAGRRKRDKDRKRKWR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSFPARHSSPPKRPKLSLQIKTPAAPQTLGKSATALKADINPSSPTAFNTLSNAYATAIENASPQILQPACFDPKAPGNIRPMPSRLQTSMTPKNEYVHPSQRTQTPGPFSISYPDTPSSAHPDSTPNLSLITAMDSAKGTPTITFTPPQSAGAIDNSSSNLAPYTHPKSLHSILRNSPLPPRSAVTPATPTTSSRLALRRANAAKSKKVGYNNPLTQTITTNKYIKSHIDLLAEDSPHSASEGDHEGGLTVLDTTMRYTGDETRDGGQTPGPFEEMRRRMAESGLETPKGKAGRRKRDKDRKRKWRWTIGVGDGEGEGEDEDVQVTPKTAVERTPITCIWRGGEDSVSPGDNVEGDADLVMSESAEEEPLTQIHEQTVSEMVGEGDEIRYEQERRGHSVELVLTDSDSSSGGEECCSRPGTSHSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.82
4 0.79
5 0.78
6 0.76
7 0.72
8 0.69
9 0.64
10 0.58
11 0.5
12 0.43
13 0.36
14 0.33
15 0.35
16 0.34
17 0.3
18 0.26
19 0.27
20 0.29
21 0.28
22 0.23
23 0.2
24 0.24
25 0.26
26 0.26
27 0.26
28 0.23
29 0.24
30 0.26
31 0.24
32 0.2
33 0.23
34 0.22
35 0.21
36 0.22
37 0.22
38 0.21
39 0.21
40 0.2
41 0.15
42 0.16
43 0.15
44 0.14
45 0.13
46 0.12
47 0.12
48 0.12
49 0.12
50 0.1
51 0.09
52 0.13
53 0.14
54 0.14
55 0.16
56 0.21
57 0.24
58 0.24
59 0.25
60 0.22
61 0.27
62 0.34
63 0.35
64 0.34
65 0.39
66 0.46
67 0.49
68 0.49
69 0.46
70 0.43
71 0.44
72 0.44
73 0.38
74 0.35
75 0.37
76 0.41
77 0.48
78 0.47
79 0.47
80 0.43
81 0.44
82 0.45
83 0.44
84 0.43
85 0.43
86 0.43
87 0.42
88 0.45
89 0.46
90 0.48
91 0.47
92 0.45
93 0.41
94 0.4
95 0.41
96 0.38
97 0.34
98 0.32
99 0.31
100 0.27
101 0.25
102 0.24
103 0.2
104 0.2
105 0.21
106 0.24
107 0.23
108 0.23
109 0.2
110 0.22
111 0.23
112 0.26
113 0.25
114 0.18
115 0.16
116 0.16
117 0.15
118 0.12
119 0.12
120 0.1
121 0.09
122 0.09
123 0.09
124 0.09
125 0.1
126 0.1
127 0.08
128 0.07
129 0.1
130 0.12
131 0.14
132 0.16
133 0.16
134 0.2
135 0.2
136 0.21
137 0.18
138 0.16
139 0.15
140 0.15
141 0.14
142 0.1
143 0.1
144 0.1
145 0.1
146 0.09
147 0.08
148 0.07
149 0.07
150 0.08
151 0.14
152 0.19
153 0.22
154 0.23
155 0.24
156 0.29
157 0.33
158 0.38
159 0.36
160 0.35
161 0.34
162 0.4
163 0.4
164 0.36
165 0.37
166 0.33
167 0.3
168 0.27
169 0.25
170 0.21
171 0.22
172 0.23
173 0.19
174 0.21
175 0.2
176 0.21
177 0.21
178 0.19
179 0.19
180 0.19
181 0.18
182 0.17
183 0.2
184 0.22
185 0.24
186 0.25
187 0.3
188 0.31
189 0.34
190 0.38
191 0.38
192 0.37
193 0.37
194 0.38
195 0.35
196 0.37
197 0.38
198 0.36
199 0.41
200 0.41
201 0.41
202 0.4
203 0.36
204 0.32
205 0.29
206 0.27
207 0.22
208 0.22
209 0.22
210 0.21
211 0.22
212 0.23
213 0.22
214 0.23
215 0.23
216 0.22
217 0.22
218 0.21
219 0.22
220 0.23
221 0.22
222 0.18
223 0.14
224 0.12
225 0.1
226 0.11
227 0.07
228 0.05
229 0.07
230 0.1
231 0.1
232 0.09
233 0.09
234 0.09
235 0.08
236 0.08
237 0.06
238 0.03
239 0.03
240 0.03
241 0.03
242 0.04
243 0.05
244 0.05
245 0.06
246 0.07
247 0.11
248 0.14
249 0.15
250 0.16
251 0.17
252 0.18
253 0.18
254 0.17
255 0.16
256 0.14
257 0.14
258 0.13
259 0.13
260 0.12
261 0.13
262 0.23
263 0.23
264 0.26
265 0.26
266 0.27
267 0.26
268 0.27
269 0.28
270 0.22
271 0.27
272 0.26
273 0.26
274 0.25
275 0.25
276 0.28
277 0.28
278 0.29
279 0.3
280 0.38
281 0.48
282 0.58
283 0.68
284 0.75
285 0.83
286 0.91
287 0.93
288 0.94
289 0.94
290 0.94
291 0.95
292 0.94
293 0.93
294 0.89
295 0.85
296 0.81
297 0.75
298 0.67
299 0.56
300 0.47
301 0.36
302 0.29
303 0.21
304 0.14
305 0.08
306 0.05
307 0.05
308 0.04
309 0.05
310 0.05
311 0.06
312 0.06
313 0.06
314 0.07
315 0.08
316 0.11
317 0.11
318 0.13
319 0.17
320 0.21
321 0.23
322 0.28
323 0.28
324 0.3
325 0.32
326 0.31
327 0.28
328 0.26
329 0.25
330 0.22
331 0.22
332 0.18
333 0.18
334 0.18
335 0.17
336 0.14
337 0.13
338 0.12
339 0.1
340 0.1
341 0.08
342 0.06
343 0.06
344 0.06
345 0.06
346 0.05
347 0.05
348 0.05
349 0.04
350 0.04
351 0.04
352 0.05
353 0.05
354 0.06
355 0.06
356 0.07
357 0.08
358 0.11
359 0.1
360 0.11
361 0.12
362 0.13
363 0.12
364 0.13
365 0.15
366 0.12
367 0.12
368 0.11
369 0.1
370 0.08
371 0.09
372 0.08
373 0.06
374 0.06
375 0.06
376 0.08
377 0.12
378 0.14
379 0.18
380 0.24
381 0.27
382 0.34
383 0.37
384 0.37
385 0.34
386 0.37
387 0.35
388 0.3
389 0.29
390 0.22
391 0.19
392 0.17
393 0.17
394 0.12
395 0.11
396 0.09
397 0.08
398 0.09
399 0.09
400 0.11
401 0.14
402 0.15
403 0.18
404 0.21
405 0.2
406 0.21