Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S7PEZ4

Protein Details
Accession A0A2S7PEZ4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-111EAEPMRIKEKKKRRIRRTKTVRSKHKYTILRBasic
NLS Segment(s)
PositionSequence
86-106RIKEKKKRRIRRTKTVRSKHK
Subcellular Location(s) nucl 10, cyto_nucl 10, mito 9, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MLPLLAVQPSHFISAHIYDRPYLVTAGDIVRLPFLMPGVSPGDVLRLNRASSLGSRDYTLKGTPYLDERIFECRARVMGTEAEPMRIKEKKKRRIRRTKTVRSKHKYTILRISELKVKTVEEIEGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.23
4 0.23
5 0.21
6 0.22
7 0.22
8 0.2
9 0.16
10 0.12
11 0.1
12 0.1
13 0.11
14 0.11
15 0.11
16 0.09
17 0.09
18 0.09
19 0.09
20 0.07
21 0.07
22 0.06
23 0.05
24 0.07
25 0.09
26 0.09
27 0.09
28 0.09
29 0.11
30 0.12
31 0.12
32 0.14
33 0.14
34 0.14
35 0.14
36 0.15
37 0.13
38 0.13
39 0.17
40 0.15
41 0.14
42 0.14
43 0.15
44 0.16
45 0.17
46 0.16
47 0.13
48 0.11
49 0.11
50 0.11
51 0.13
52 0.15
53 0.14
54 0.14
55 0.14
56 0.18
57 0.2
58 0.19
59 0.17
60 0.14
61 0.14
62 0.14
63 0.14
64 0.11
65 0.12
66 0.12
67 0.17
68 0.17
69 0.19
70 0.19
71 0.19
72 0.22
73 0.24
74 0.27
75 0.32
76 0.43
77 0.51
78 0.61
79 0.72
80 0.78
81 0.85
82 0.91
83 0.92
84 0.93
85 0.94
86 0.94
87 0.94
88 0.93
89 0.9
90 0.88
91 0.85
92 0.83
93 0.79
94 0.75
95 0.75
96 0.68
97 0.66
98 0.6
99 0.55
100 0.54
101 0.47
102 0.43
103 0.34
104 0.31
105 0.27
106 0.26
107 0.24