FuNGI

A0A2S7PF11

Protein Details

Accession

A0A2S7PF11

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
457-481	CENRWFVKQKNFKGRVLRRKDGGKS	Hydrophilic

NLS Segment(s)

Position	Sequence
469-480	KGRVLRRKDGGK

Subcellular Location(s)

extr 6, mito 5, cyto 5, cyto_mito 5, plas 4

Family & Domain DBs

InterPro	View protein in InterPro IPR001128 Cyt_P450 IPR002401 Cyt_P450_E_grp-I IPR036396 Cyt_P450_sf
Gene Ontology	GO:0016020 C:membrane GO:0020037 F:heme binding GO:0005506 F:iron ion binding GO:0004497 F:monooxygenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Pfam	View protein in Pfam PF00067 p450
CDD	cd11060 CYP57A1-like

Amino Acid Sequences

MLQTILSLPTWVLITLLPTIYILHVLLAAALSPLRHIPGPFLARFTRLWYCLSIYRGSYERENLALHRKYGPIVRIAPNEYSIDSPSACRTIYSTSNSHFLKAPWYKAWMPPDPSKASLFSDLNPHRHGSQRRKFASYYSMSSLVGYERFVDNCTEMLCARFRELSDYERGAVDLQHWLQCYAFDVIGEITFGKRFGFLEMGEDETGGHGYVLGYTMRRIEERVKVLKDPRIAEEKAREGTPDIMTRILMASEKDPEKVTRGDLITMCQSNIGAGSDTTAITLSSVLYHLLKFPETYQKLRKEIDDAEKEGRISDPITFKEAQGLPYLQAAIKEGLRVHPAVGLGLQRVVPSEGANLAGEFIPGGSTVGINAWVAHRNSTVFGADAETWRPERWLEIEEQGRGGEVDKYFLSFGLASRTCIGKNISLLEMSKLIPQLIRRFDFELDKELEKDDGLICENRWFVKQKNFKGRVLRRKDGGKS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.09
2	0.11
3	0.11
4	0.1
5	0.1
6	0.11
7	0.1
8	0.11
9	0.09
10	0.07
11	0.08
12	0.07
13	0.07
14	0.06
15	0.06
16	0.05
17	0.06
18	0.05
19	0.06
20	0.07
21	0.1
22	0.12
23	0.12
24	0.15
25	0.23
26	0.29
27	0.29
28	0.33
29	0.32
30	0.33
31	0.33
32	0.36
33	0.34
34	0.3
35	0.31
36	0.28
37	0.31
38	0.33
39	0.35
40	0.32
41	0.27
42	0.29
43	0.3
44	0.31
45	0.31
46	0.3
47	0.29
48	0.28
49	0.28
50	0.28
51	0.35
52	0.34
53	0.33
54	0.33
55	0.32
56	0.32
57	0.36
58	0.35
59	0.32
60	0.35
61	0.39
62	0.4
63	0.42
64	0.41
65	0.38
66	0.37
67	0.31
68	0.27
69	0.22
70	0.19
71	0.17
72	0.17
73	0.17
74	0.17
75	0.16
76	0.15
77	0.15
78	0.18
79	0.22
80	0.26
81	0.27
82	0.27
83	0.35
84	0.35
85	0.35
86	0.32
87	0.27
88	0.33
89	0.34
90	0.36
91	0.31
92	0.36
93	0.37
94	0.41
95	0.47
96	0.44
97	0.45
98	0.47
99	0.51
100	0.49
101	0.49
102	0.45
103	0.4
104	0.36
105	0.36
106	0.31
107	0.25
108	0.32
109	0.34
110	0.36
111	0.36
112	0.35
113	0.31
114	0.39
115	0.47
116	0.48
117	0.52
118	0.58
119	0.6
120	0.63
121	0.61
122	0.56
123	0.55
124	0.48
125	0.43
126	0.37
127	0.34
128	0.3
129	0.29
130	0.27
131	0.2
132	0.16
133	0.12
134	0.1
135	0.1
136	0.1
137	0.11
138	0.12
139	0.11
140	0.11
141	0.11
142	0.11
143	0.09
144	0.11
145	0.12
146	0.12
147	0.13
148	0.14
149	0.13
150	0.17
151	0.19
152	0.2
153	0.23
154	0.23
155	0.22
156	0.21
157	0.21
158	0.16
159	0.14
160	0.12
161	0.11
162	0.11
163	0.13
164	0.13
165	0.13
166	0.13
167	0.12
168	0.14
169	0.11
170	0.1
171	0.08
172	0.08
173	0.08
174	0.08
175	0.08
176	0.06
177	0.05
178	0.05
179	0.06
180	0.05
181	0.06
182	0.06
183	0.07
184	0.08
185	0.08
186	0.1
187	0.11
188	0.12
189	0.12
190	0.11
191	0.1
192	0.09
193	0.09
194	0.06
195	0.05
196	0.03
197	0.03
198	0.03
199	0.04
200	0.05
201	0.05
202	0.05
203	0.07
204	0.07
205	0.08
206	0.1
207	0.13
208	0.18
209	0.23
210	0.29
211	0.29
212	0.32
213	0.36
214	0.39
215	0.39
216	0.35
217	0.33
218	0.33
219	0.32
220	0.3
221	0.3
222	0.29
223	0.26
224	0.24
225	0.22
226	0.17
227	0.19
228	0.18
229	0.16
230	0.13
231	0.12
232	0.12
233	0.12
234	0.11
235	0.08
236	0.07
237	0.06
238	0.06
239	0.1
240	0.11
241	0.12
242	0.13
243	0.13
244	0.15
245	0.16
246	0.16
247	0.16
248	0.16
249	0.17
250	0.17
251	0.18
252	0.18
253	0.17
254	0.16
255	0.12
256	0.11
257	0.09
258	0.09
259	0.08
260	0.05
261	0.04
262	0.05
263	0.06
264	0.06
265	0.06
266	0.06
267	0.05
268	0.05
269	0.05
270	0.04
271	0.04
272	0.04
273	0.05
274	0.06
275	0.06
276	0.07
277	0.08
278	0.08
279	0.09
280	0.1
281	0.2
282	0.22
283	0.28
284	0.34
285	0.4
286	0.44
287	0.45
288	0.44
289	0.38
290	0.41
291	0.44
292	0.41
293	0.38
294	0.36
295	0.36
296	0.35
297	0.31
298	0.25
299	0.17
300	0.14
301	0.14
302	0.15
303	0.15
304	0.19
305	0.2
306	0.19
307	0.25
308	0.25
309	0.23
310	0.22
311	0.22
312	0.18
313	0.18
314	0.19
315	0.12
316	0.11
317	0.12
318	0.11
319	0.1
320	0.11
321	0.11
322	0.13
323	0.14
324	0.14
325	0.13
326	0.13
327	0.13
328	0.11
329	0.12
330	0.11
331	0.09
332	0.1
333	0.1
334	0.08
335	0.09
336	0.1
337	0.09
338	0.08
339	0.09
340	0.08
341	0.09
342	0.09
343	0.08
344	0.08
345	0.08
346	0.07
347	0.06
348	0.05
349	0.05
350	0.04
351	0.05
352	0.04
353	0.04
354	0.04
355	0.05
356	0.05
357	0.05
358	0.06
359	0.07
360	0.12
361	0.13
362	0.14
363	0.15
364	0.15
365	0.17
366	0.18
367	0.16
368	0.12
369	0.12
370	0.13
371	0.13
372	0.14
373	0.14
374	0.15
375	0.16
376	0.16
377	0.17
378	0.15
379	0.16
380	0.17
381	0.18
382	0.19
383	0.24
384	0.28
385	0.28
386	0.28
387	0.25
388	0.23
389	0.2
390	0.18
391	0.16
392	0.12
393	0.14
394	0.13
395	0.14
396	0.14
397	0.14
398	0.15
399	0.11
400	0.11
401	0.18
402	0.18
403	0.19
404	0.21
405	0.23
406	0.21
407	0.24
408	0.26
409	0.21
410	0.23
411	0.24
412	0.23
413	0.23
414	0.24
415	0.23
416	0.22
417	0.2
418	0.2
419	0.18
420	0.18
421	0.18
422	0.23
423	0.29
424	0.35
425	0.36
426	0.37
427	0.39
428	0.41
429	0.45
430	0.42
431	0.4
432	0.36
433	0.36
434	0.34
435	0.32
436	0.3
437	0.23
438	0.23
439	0.17
440	0.15
441	0.16
442	0.18
443	0.17
444	0.21
445	0.23
446	0.23
447	0.26
448	0.29
449	0.32
450	0.41
451	0.5
452	0.56
453	0.66
454	0.7
455	0.73
456	0.79
457	0.83
458	0.83
459	0.83
460	0.81
461	0.77

A0A2S7PF11

3D AlphaFold-predicted Structure Viewer