Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7S5Q0

Protein Details
Accession J7S5Q0    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-100ADPLAARRKELRRKHRNEIKQSNYLSQHydrophilic
NLS Segment(s)
PositionSequence
79-89ARRKELRRKHR
Subcellular Location(s) mito 19, cyto 4, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MWRFVQRRMWHGGRVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVLEPATGGDASARADPLAARRKELRRKHRNEIKQSNYLSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.32
4 0.29
5 0.25
6 0.23
7 0.19
8 0.16
9 0.14
10 0.13
11 0.13
12 0.12
13 0.11
14 0.12
15 0.1
16 0.09
17 0.1
18 0.1
19 0.11
20 0.12
21 0.15
22 0.17
23 0.18
24 0.18
25 0.23
26 0.28
27 0.29
28 0.29
29 0.31
30 0.3
31 0.33
32 0.33
33 0.3
34 0.3
35 0.27
36 0.27
37 0.23
38 0.24
39 0.19
40 0.2
41 0.18
42 0.12
43 0.13
44 0.12
45 0.11
46 0.08
47 0.1
48 0.08
49 0.06
50 0.07
51 0.06
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.07
59 0.07
60 0.06
61 0.06
62 0.07
63 0.14
64 0.23
65 0.23
66 0.26
67 0.34
68 0.44
69 0.54
70 0.64
71 0.68
72 0.7
73 0.78
74 0.85
75 0.88
76 0.89
77 0.9
78 0.9
79 0.87
80 0.85
81 0.8