Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4L9F4

Protein Details
Accession A0A2S4L9F4   
Localization Confidence High
Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
241-261GEQRGPRPKEARRRANRLGLGBasic
273-336GWNQNGGRKKRPRLDEYRREESKRKESRRHEDSYKKERDRERDAYRDRDRDRDRQRDYDRGRRRBasic
NLS Segment(s)
PositionSequence
244-264RGPRPKEARRRANRLGLGAKE
277-336NGGRKKRPRLDEYRREESKRKESRRHEDSYKKERDRERDAYRDRDRDRDRQRDYDRGRRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MGDPEKGRIAIKFGTPSTSNRPSPRPNPPSSLGKRSRPHALGAGSDSESDDEHHHRGRHEVITGFGADGAETERERRAKDAAKKEFVIERQPNRDWRAEVKAQRPGKNLLPEEARAQRNGTAVETEPADQDKEIKWGLTVKEKPATGDDQPTGDTPGKSPQQPNGHAQPAPERTTDDEAMDALLGRTSKKQKTIPQPALSEDDAYRRDAETAGAASTLEDYEAMPVEEFGAALLRGMGWNGEQRGPRPKEARRRANRLGLGAKELKEAEDLGGWNQNGGRKKRPRLDEYRREESKRKESRRHEDSYKKERDRERDAYRDRDRDRDRQRDYDRGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.41
5 0.46
6 0.48
7 0.49
8 0.56
9 0.6
10 0.66
11 0.72
12 0.72
13 0.7
14 0.7
15 0.7
16 0.72
17 0.7
18 0.73
19 0.7
20 0.7
21 0.7
22 0.68
23 0.72
24 0.63
25 0.59
26 0.54
27 0.49
28 0.42
29 0.39
30 0.37
31 0.29
32 0.27
33 0.24
34 0.18
35 0.16
36 0.15
37 0.16
38 0.16
39 0.2
40 0.25
41 0.27
42 0.27
43 0.31
44 0.35
45 0.34
46 0.33
47 0.3
48 0.27
49 0.26
50 0.25
51 0.21
52 0.17
53 0.14
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.1
60 0.14
61 0.17
62 0.18
63 0.2
64 0.25
65 0.32
66 0.41
67 0.5
68 0.53
69 0.56
70 0.56
71 0.57
72 0.56
73 0.5
74 0.51
75 0.48
76 0.47
77 0.48
78 0.52
79 0.56
80 0.55
81 0.56
82 0.48
83 0.45
84 0.46
85 0.46
86 0.49
87 0.48
88 0.53
89 0.56
90 0.59
91 0.57
92 0.54
93 0.52
94 0.53
95 0.48
96 0.43
97 0.39
98 0.35
99 0.37
100 0.4
101 0.35
102 0.28
103 0.28
104 0.26
105 0.25
106 0.25
107 0.2
108 0.15
109 0.14
110 0.14
111 0.14
112 0.12
113 0.11
114 0.11
115 0.11
116 0.09
117 0.1
118 0.1
119 0.12
120 0.11
121 0.11
122 0.1
123 0.14
124 0.16
125 0.23
126 0.24
127 0.24
128 0.28
129 0.28
130 0.29
131 0.27
132 0.29
133 0.21
134 0.23
135 0.2
136 0.17
137 0.18
138 0.17
139 0.18
140 0.17
141 0.15
142 0.12
143 0.17
144 0.19
145 0.21
146 0.22
147 0.26
148 0.31
149 0.34
150 0.38
151 0.37
152 0.37
153 0.35
154 0.34
155 0.33
156 0.3
157 0.29
158 0.25
159 0.21
160 0.21
161 0.24
162 0.24
163 0.18
164 0.14
165 0.12
166 0.12
167 0.11
168 0.08
169 0.04
170 0.04
171 0.05
172 0.05
173 0.1
174 0.16
175 0.19
176 0.25
177 0.3
178 0.38
179 0.48
180 0.59
181 0.62
182 0.61
183 0.6
184 0.57
185 0.55
186 0.47
187 0.38
188 0.28
189 0.24
190 0.2
191 0.19
192 0.18
193 0.14
194 0.14
195 0.13
196 0.12
197 0.09
198 0.09
199 0.08
200 0.07
201 0.07
202 0.06
203 0.06
204 0.06
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.05
216 0.04
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.08
227 0.1
228 0.14
229 0.16
230 0.19
231 0.29
232 0.33
233 0.39
234 0.43
235 0.5
236 0.57
237 0.66
238 0.75
239 0.74
240 0.8
241 0.8
242 0.82
243 0.77
244 0.71
245 0.66
246 0.57
247 0.53
248 0.48
249 0.41
250 0.34
251 0.31
252 0.26
253 0.21
254 0.2
255 0.15
256 0.13
257 0.13
258 0.12
259 0.16
260 0.15
261 0.15
262 0.17
263 0.21
264 0.27
265 0.31
266 0.4
267 0.45
268 0.55
269 0.63
270 0.7
271 0.75
272 0.78
273 0.84
274 0.84
275 0.84
276 0.84
277 0.83
278 0.8
279 0.79
280 0.77
281 0.77
282 0.77
283 0.78
284 0.79
285 0.82
286 0.86
287 0.86
288 0.85
289 0.84
290 0.84
291 0.84
292 0.84
293 0.85
294 0.81
295 0.81
296 0.82
297 0.8
298 0.79
299 0.79
300 0.77
301 0.77
302 0.77
303 0.79
304 0.8
305 0.81
306 0.75
307 0.76
308 0.74
309 0.74
310 0.78
311 0.78
312 0.76
313 0.77
314 0.8
315 0.8
316 0.82