Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4KM25

Protein Details
Accession A0A2S4KM25    Localization Confidence High Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
297-321SGRKRGAPGSTKPKRRRPEYDSDDDBasic
361-385GVEDSGRRRSKKQRTREPEEDEDAEAcidic
NLS Segment(s)
PositionSequence
260-266MKAQRRR
292-313GRGLGSGRKRGAPGSTKPKRRR
369-371RSK
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007149  Leo1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF04004  Leo1  
Amino Acid Sequences MSDSEDPLDVVDEGGEDLFGDEGEDEAASPPARVLDDDELASDADEDADAPNRDYDDDMPQENRGRVVAELTTYRHRTPKPRDSMLRVMRVPKFIKFMPEVYAPDTFEPTEFDVANAKAEQPRHVARVRRDSSTGELKSNTNIYRWSDGSVTISVGGEHYEIQKKLLATGPNQPYNELHDGHYYAAAAELGCNMLMTVGHLKEQYNVRPNKAVGDDALSLFAERMAQASKAYKGEKMIVRTTRDPELQKKQAEMAEKERMKAQRRRENAALKMDGGLGRSGRGGLSIGDLEGRGLGSGRKRGAPGSTKPKRRRPEYDSDDDLPQGVGRHEDYDMDDGFLVGSDEEEMESGAGEDDDEELLGVEDSGRRRSKKQRTREPEEDEDAEGDDVDAEPSSRARRRNVVDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.09
15 0.09
16 0.09
17 0.09
18 0.1
19 0.11
20 0.11
21 0.15
22 0.17
23 0.19
24 0.19
25 0.19
26 0.18
27 0.18
28 0.17
29 0.13
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.11
36 0.12
37 0.13
38 0.14
39 0.14
40 0.15
41 0.17
42 0.18
43 0.2
44 0.22
45 0.24
46 0.25
47 0.28
48 0.32
49 0.31
50 0.3
51 0.24
52 0.22
53 0.19
54 0.2
55 0.17
56 0.14
57 0.16
58 0.19
59 0.26
60 0.28
61 0.31
62 0.36
63 0.4
64 0.48
65 0.55
66 0.62
67 0.64
68 0.7
69 0.74
70 0.75
71 0.8
72 0.77
73 0.75
74 0.68
75 0.66
76 0.6
77 0.6
78 0.54
79 0.47
80 0.44
81 0.37
82 0.39
83 0.35
84 0.33
85 0.3
86 0.32
87 0.3
88 0.28
89 0.29
90 0.25
91 0.23
92 0.23
93 0.19
94 0.15
95 0.15
96 0.15
97 0.15
98 0.13
99 0.13
100 0.15
101 0.15
102 0.16
103 0.14
104 0.14
105 0.15
106 0.17
107 0.19
108 0.2
109 0.23
110 0.27
111 0.32
112 0.37
113 0.4
114 0.5
115 0.51
116 0.48
117 0.48
118 0.45
119 0.45
120 0.47
121 0.42
122 0.33
123 0.32
124 0.3
125 0.3
126 0.32
127 0.28
128 0.2
129 0.21
130 0.22
131 0.23
132 0.23
133 0.23
134 0.19
135 0.18
136 0.19
137 0.17
138 0.14
139 0.11
140 0.1
141 0.09
142 0.08
143 0.08
144 0.06
145 0.06
146 0.09
147 0.13
148 0.13
149 0.14
150 0.16
151 0.15
152 0.17
153 0.2
154 0.19
155 0.17
156 0.26
157 0.31
158 0.34
159 0.34
160 0.33
161 0.3
162 0.33
163 0.33
164 0.26
165 0.21
166 0.18
167 0.18
168 0.18
169 0.17
170 0.12
171 0.09
172 0.08
173 0.07
174 0.05
175 0.04
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.06
185 0.06
186 0.07
187 0.08
188 0.08
189 0.12
190 0.15
191 0.18
192 0.25
193 0.27
194 0.27
195 0.3
196 0.29
197 0.29
198 0.27
199 0.23
200 0.15
201 0.16
202 0.15
203 0.12
204 0.13
205 0.1
206 0.09
207 0.08
208 0.08
209 0.05
210 0.04
211 0.05
212 0.05
213 0.05
214 0.07
215 0.08
216 0.11
217 0.14
218 0.15
219 0.15
220 0.16
221 0.21
222 0.23
223 0.26
224 0.3
225 0.31
226 0.35
227 0.37
228 0.38
229 0.36
230 0.38
231 0.38
232 0.39
233 0.44
234 0.46
235 0.44
236 0.42
237 0.42
238 0.4
239 0.42
240 0.37
241 0.34
242 0.37
243 0.37
244 0.36
245 0.38
246 0.42
247 0.45
248 0.48
249 0.53
250 0.52
251 0.56
252 0.63
253 0.65
254 0.66
255 0.64
256 0.64
257 0.55
258 0.46
259 0.42
260 0.36
261 0.29
262 0.22
263 0.17
264 0.11
265 0.1
266 0.1
267 0.09
268 0.08
269 0.07
270 0.07
271 0.06
272 0.07
273 0.07
274 0.07
275 0.07
276 0.07
277 0.07
278 0.06
279 0.06
280 0.04
281 0.05
282 0.07
283 0.11
284 0.16
285 0.18
286 0.2
287 0.21
288 0.23
289 0.29
290 0.33
291 0.38
292 0.45
293 0.52
294 0.61
295 0.69
296 0.77
297 0.81
298 0.82
299 0.83
300 0.8
301 0.82
302 0.8
303 0.79
304 0.76
305 0.69
306 0.62
307 0.52
308 0.44
309 0.33
310 0.25
311 0.19
312 0.12
313 0.11
314 0.11
315 0.12
316 0.12
317 0.13
318 0.14
319 0.16
320 0.16
321 0.15
322 0.14
323 0.12
324 0.12
325 0.1
326 0.09
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.05
333 0.05
334 0.05
335 0.05
336 0.05
337 0.05
338 0.04
339 0.04
340 0.05
341 0.05
342 0.05
343 0.05
344 0.05
345 0.05
346 0.05
347 0.05
348 0.05
349 0.05
350 0.09
351 0.11
352 0.19
353 0.25
354 0.29
355 0.37
356 0.48
357 0.59
358 0.65
359 0.74
360 0.78
361 0.82
362 0.89
363 0.9
364 0.88
365 0.85
366 0.81
367 0.72
368 0.62
369 0.53
370 0.44
371 0.34
372 0.25
373 0.18
374 0.11
375 0.09
376 0.08
377 0.07
378 0.07
379 0.07
380 0.11
381 0.19
382 0.24
383 0.3
384 0.36
385 0.45
386 0.52
387 0.61
388 0.66