Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KVQ2

Protein Details
Accession A0A2S4KVQ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76RRLQSKCRSCHRWRRVDKGSBasic
NLS Segment(s)
Subcellular Location(s) cysk 11, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MSGWWEVNSKGGIYGCWAAGSGAVQGTSCSGALYAFAVSPVPEMPYRISFSIHDMYRRLQSKCRSCHRWRRVDKGSALEVVVNCQGEDERILKGAHLVYIGSGLMAPIQGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.13
5 0.1
6 0.1
7 0.1
8 0.08
9 0.06
10 0.06
11 0.06
12 0.06
13 0.07
14 0.07
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.07
29 0.07
30 0.08
31 0.1
32 0.12
33 0.14
34 0.14
35 0.15
36 0.14
37 0.17
38 0.21
39 0.2
40 0.19
41 0.19
42 0.2
43 0.24
44 0.28
45 0.26
46 0.27
47 0.35
48 0.41
49 0.48
50 0.56
51 0.59
52 0.64
53 0.74
54 0.77
55 0.8
56 0.79
57 0.8
58 0.79
59 0.77
60 0.72
61 0.65
62 0.58
63 0.48
64 0.41
65 0.33
66 0.25
67 0.2
68 0.18
69 0.14
70 0.11
71 0.1
72 0.1
73 0.09
74 0.11
75 0.1
76 0.09
77 0.11
78 0.12
79 0.11
80 0.14
81 0.14
82 0.13
83 0.12
84 0.11
85 0.09
86 0.1
87 0.09
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05