Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KZX0

Protein Details
Accession A0A2S4KZX0   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-29RDSSNTRISKKSRPRHRPGPCHHLHTBasic
NLS Segment(s)
PositionSequence
15-17SRP
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEQRDSSNTRISKKSRPRHRPGPCHHLHTTAIDLRAANPLARLASPRTLIPARLARPLRLVSLAALGAPCVHRNRFAHREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.78
4 0.82
5 0.84
6 0.9
7 0.9
8 0.88
9 0.88
10 0.81
11 0.78
12 0.7
13 0.63
14 0.53
15 0.44
16 0.4
17 0.32
18 0.27
19 0.21
20 0.19
21 0.16
22 0.17
23 0.16
24 0.12
25 0.09
26 0.09
27 0.09
28 0.09
29 0.1
30 0.09
31 0.11
32 0.12
33 0.12
34 0.16
35 0.16
36 0.16
37 0.2
38 0.24
39 0.23
40 0.3
41 0.32
42 0.29
43 0.32
44 0.33
45 0.3
46 0.25
47 0.24
48 0.16
49 0.16
50 0.15
51 0.11
52 0.1
53 0.09
54 0.09
55 0.09
56 0.13
57 0.15
58 0.17
59 0.24
60 0.27
61 0.37