Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KPE3

Protein Details
Accession A0A2S4KPE3   
Localization Confidence High
Confidence Score 20.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-102IDGVPKAKHAPKKKKPAIRHPQARQVDEBasic
483-505EPEGRAERKKGWRRVQDDLDNNEAcidic
NLS Segment(s)
PositionSequence
80-94KAKHAPKKKKPAIRH
474-495PKGKGKDAGEPEGRAERKKGWR
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039128  TRIP4-like  
IPR009349  Znf_C2HC5  
Gene Ontology GO:0005634  C:nucleus  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF06221  zf-C2HC5  
Amino Acid Sequences MSLAQLSQLLPLPEEDLRQVLEYAATLSKPEAAAHFSNLLGDSPLAVDFISSFNSHRRAPQAAPAQLSGAASDAIDGVPKAKHAPKKKKPAIRHPQARQVDEYAGPSSTAYSKKGQDLEYIPQRASAPSSNHASRSATPLQPPAQPPPKQHASSTGFLISDLPSKGKAKSNPSSRSSTPKPSSANSTKISIAGGTPMAGQSTALADLDAAIRALEITTNPSLGSGRQRKCNCVAMRHPLQSAAPNCLSCGKVICMKEGLGPCTFCGSPLFRPDEVQAMIRELKDERGREKMAANASAHRRADVAKTPAPFTKPRGGGDGDDDSLADAATKAREHRDKLLNFQEQNARRTTVRDEAADFDMSGAMTGTGSMWASPEERAKELKRQQKLMREMEWNAQPDYEKRRQVISIDLVSGKVVRKMAAVKRPVTPDSGEDEAANGVLGETTGNAKGASHGGGAFSGNPLLGALMRPVFEPPKGKGKDAGEPEGRAERKKGWRRVQDDLDNNEEVILDGGVYGYSGGGAAGDEPACG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.16
5 0.17
6 0.17
7 0.14
8 0.13
9 0.12
10 0.13
11 0.13
12 0.12
13 0.11
14 0.12
15 0.14
16 0.14
17 0.15
18 0.14
19 0.18
20 0.19
21 0.22
22 0.23
23 0.2
24 0.21
25 0.2
26 0.19
27 0.14
28 0.12
29 0.1
30 0.09
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.07
37 0.09
38 0.09
39 0.11
40 0.17
41 0.21
42 0.23
43 0.27
44 0.31
45 0.34
46 0.35
47 0.42
48 0.46
49 0.46
50 0.47
51 0.43
52 0.39
53 0.35
54 0.33
55 0.24
56 0.15
57 0.11
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.09
67 0.14
68 0.21
69 0.3
70 0.4
71 0.51
72 0.6
73 0.71
74 0.8
75 0.84
76 0.88
77 0.9
78 0.91
79 0.9
80 0.91
81 0.87
82 0.87
83 0.85
84 0.78
85 0.7
86 0.61
87 0.53
88 0.44
89 0.39
90 0.3
91 0.23
92 0.2
93 0.16
94 0.15
95 0.16
96 0.17
97 0.17
98 0.21
99 0.23
100 0.28
101 0.32
102 0.32
103 0.33
104 0.35
105 0.4
106 0.44
107 0.43
108 0.38
109 0.36
110 0.36
111 0.31
112 0.31
113 0.27
114 0.23
115 0.25
116 0.31
117 0.31
118 0.32
119 0.33
120 0.33
121 0.29
122 0.32
123 0.33
124 0.3
125 0.3
126 0.34
127 0.35
128 0.36
129 0.38
130 0.4
131 0.43
132 0.45
133 0.46
134 0.49
135 0.54
136 0.51
137 0.49
138 0.49
139 0.46
140 0.43
141 0.42
142 0.36
143 0.27
144 0.26
145 0.26
146 0.17
147 0.15
148 0.14
149 0.13
150 0.14
151 0.16
152 0.19
153 0.24
154 0.29
155 0.34
156 0.42
157 0.51
158 0.55
159 0.58
160 0.61
161 0.57
162 0.61
163 0.57
164 0.59
165 0.52
166 0.51
167 0.49
168 0.45
169 0.52
170 0.48
171 0.49
172 0.41
173 0.4
174 0.35
175 0.32
176 0.3
177 0.21
178 0.16
179 0.11
180 0.09
181 0.07
182 0.07
183 0.06
184 0.06
185 0.06
186 0.05
187 0.04
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.04
197 0.03
198 0.03
199 0.03
200 0.04
201 0.03
202 0.03
203 0.07
204 0.07
205 0.07
206 0.07
207 0.08
208 0.08
209 0.09
210 0.19
211 0.25
212 0.28
213 0.36
214 0.38
215 0.41
216 0.45
217 0.52
218 0.46
219 0.44
220 0.46
221 0.46
222 0.5
223 0.48
224 0.45
225 0.37
226 0.35
227 0.33
228 0.29
229 0.25
230 0.2
231 0.18
232 0.18
233 0.19
234 0.19
235 0.13
236 0.14
237 0.11
238 0.14
239 0.15
240 0.16
241 0.14
242 0.14
243 0.18
244 0.18
245 0.19
246 0.15
247 0.15
248 0.14
249 0.15
250 0.15
251 0.11
252 0.12
253 0.12
254 0.13
255 0.17
256 0.21
257 0.19
258 0.2
259 0.2
260 0.22
261 0.2
262 0.19
263 0.15
264 0.13
265 0.15
266 0.13
267 0.14
268 0.11
269 0.15
270 0.18
271 0.2
272 0.19
273 0.23
274 0.25
275 0.25
276 0.25
277 0.25
278 0.23
279 0.25
280 0.23
281 0.24
282 0.26
283 0.3
284 0.29
285 0.25
286 0.24
287 0.21
288 0.24
289 0.24
290 0.26
291 0.24
292 0.25
293 0.27
294 0.28
295 0.31
296 0.3
297 0.29
298 0.31
299 0.31
300 0.31
301 0.32
302 0.32
303 0.29
304 0.3
305 0.28
306 0.2
307 0.17
308 0.16
309 0.12
310 0.11
311 0.1
312 0.06
313 0.04
314 0.04
315 0.05
316 0.06
317 0.08
318 0.14
319 0.2
320 0.22
321 0.3
322 0.38
323 0.39
324 0.45
325 0.52
326 0.52
327 0.48
328 0.49
329 0.5
330 0.46
331 0.47
332 0.42
333 0.36
334 0.29
335 0.31
336 0.31
337 0.29
338 0.27
339 0.26
340 0.25
341 0.26
342 0.28
343 0.26
344 0.21
345 0.15
346 0.13
347 0.11
348 0.1
349 0.07
350 0.04
351 0.04
352 0.04
353 0.04
354 0.04
355 0.04
356 0.04
357 0.04
358 0.05
359 0.07
360 0.08
361 0.13
362 0.14
363 0.16
364 0.22
365 0.24
366 0.33
367 0.41
368 0.47
369 0.5
370 0.56
371 0.6
372 0.65
373 0.71
374 0.67
375 0.64
376 0.6
377 0.57
378 0.54
379 0.53
380 0.46
381 0.37
382 0.32
383 0.29
384 0.28
385 0.35
386 0.36
387 0.35
388 0.35
389 0.37
390 0.38
391 0.38
392 0.4
393 0.37
394 0.31
395 0.29
396 0.28
397 0.25
398 0.23
399 0.24
400 0.18
401 0.16
402 0.15
403 0.13
404 0.15
405 0.22
406 0.3
407 0.36
408 0.41
409 0.4
410 0.45
411 0.5
412 0.49
413 0.44
414 0.39
415 0.33
416 0.32
417 0.32
418 0.27
419 0.22
420 0.21
421 0.18
422 0.16
423 0.13
424 0.08
425 0.05
426 0.04
427 0.04
428 0.03
429 0.04
430 0.06
431 0.07
432 0.07
433 0.07
434 0.07
435 0.09
436 0.11
437 0.11
438 0.1
439 0.1
440 0.1
441 0.11
442 0.11
443 0.1
444 0.09
445 0.09
446 0.07
447 0.07
448 0.06
449 0.06
450 0.06
451 0.06
452 0.08
453 0.09
454 0.1
455 0.1
456 0.14
457 0.16
458 0.2
459 0.24
460 0.25
461 0.35
462 0.37
463 0.39
464 0.42
465 0.44
466 0.49
467 0.5
468 0.55
469 0.49
470 0.47
471 0.49
472 0.51
473 0.49
474 0.43
475 0.41
476 0.41
477 0.48
478 0.57
479 0.64
480 0.65
481 0.73
482 0.76
483 0.82
484 0.83
485 0.82
486 0.8
487 0.75
488 0.7
489 0.61
490 0.55
491 0.45
492 0.35
493 0.25
494 0.18
495 0.12
496 0.06
497 0.05
498 0.05
499 0.05
500 0.05
501 0.05
502 0.03
503 0.03
504 0.04
505 0.03
506 0.03
507 0.04
508 0.04
509 0.07