Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KMT1

Protein Details
Accession A0A2S4KMT1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-53VRSQDPRCHNRPSPRPPRQLDCFVVSSVPSTRHRHRQCRPSRPVPSRSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences LSCFVRSQDPRCHNRPSPRPPRQLDCFVVSSVPSTRHRHRQCRPSRPVPSRSTSVAMSIPPSGHRRPVVPLRRSHTRTFSVGSTELAGPSSPSPSKPPLLLARARQTVQDSPLNKARATQAASAPLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.77
4 0.79
5 0.82
6 0.87
7 0.84
8 0.84
9 0.8
10 0.77
11 0.7
12 0.63
13 0.55
14 0.45
15 0.39
16 0.31
17 0.26
18 0.2
19 0.21
20 0.22
21 0.27
22 0.33
23 0.43
24 0.52
25 0.61
26 0.67
27 0.73
28 0.78
29 0.82
30 0.85
31 0.85
32 0.86
33 0.83
34 0.82
35 0.77
36 0.71
37 0.63
38 0.56
39 0.48
40 0.38
41 0.32
42 0.25
43 0.2
44 0.16
45 0.14
46 0.12
47 0.12
48 0.16
49 0.15
50 0.17
51 0.18
52 0.17
53 0.22
54 0.31
55 0.37
56 0.38
57 0.43
58 0.46
59 0.54
60 0.58
61 0.56
62 0.52
63 0.47
64 0.44
65 0.4
66 0.36
67 0.29
68 0.26
69 0.23
70 0.19
71 0.16
72 0.14
73 0.12
74 0.11
75 0.09
76 0.08
77 0.12
78 0.11
79 0.12
80 0.16
81 0.19
82 0.22
83 0.21
84 0.26
85 0.29
86 0.34
87 0.38
88 0.4
89 0.44
90 0.47
91 0.46
92 0.43
93 0.42
94 0.39
95 0.39
96 0.4
97 0.33
98 0.35
99 0.42
100 0.42
101 0.37
102 0.37
103 0.36
104 0.36
105 0.38
106 0.36
107 0.32
108 0.4