Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4LAH4

Protein Details
Accession A0A2S4LAH4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
98-123EDKARVLEKTKKRNTHFPQRKFAVKAHydrophilic
NLS Segment(s)
PositionSequence
88-117TRAIRRRLSPEDKARVLEKTKKRNTHFPQR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSGKVKAIQLWDKSKDDLTKQLAELKAELGQLRIQKIASSSTKLNKIHDLRKSIARVLTVINAKQRSQLRLFYKNKKYAPLDLRLKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.44
4 0.44
5 0.42
6 0.4
7 0.38
8 0.43
9 0.39
10 0.36
11 0.33
12 0.26
13 0.23
14 0.21
15 0.19
16 0.14
17 0.15
18 0.17
19 0.18
20 0.17
21 0.15
22 0.15
23 0.15
24 0.2
25 0.19
26 0.19
27 0.22
28 0.26
29 0.33
30 0.34
31 0.35
32 0.38
33 0.41
34 0.45
35 0.47
36 0.46
37 0.42
38 0.46
39 0.46
40 0.4
41 0.35
42 0.29
43 0.24
44 0.2
45 0.22
46 0.18
47 0.17
48 0.19
49 0.19
50 0.19
51 0.24
52 0.25
53 0.25
54 0.26
55 0.32
56 0.33
57 0.42
58 0.49
59 0.53
60 0.59
61 0.63
62 0.63
63 0.62
64 0.6
65 0.58
66 0.56
67 0.56
68 0.55
69 0.52
70 0.59
71 0.56
72 0.55
73 0.51
74 0.54
75 0.54
76 0.53
77 0.58
78 0.55
79 0.58
80 0.66
81 0.7
82 0.7
83 0.69
84 0.72
85 0.71
86 0.67
87 0.62
88 0.56
89 0.53
90 0.52
91 0.53
92 0.53
93 0.55
94 0.63
95 0.7
96 0.74
97 0.79
98 0.81
99 0.83
100 0.84
101 0.82
102 0.83
103 0.8
104 0.82