Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4L858

Protein Details
Accession A0A2S4L858   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
118-139NENYRLEQQRQQRQQQQESRGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018793  Cyt_c_oxidase_assmbl_Pet191  
Pfam View protein in Pfam  
PF10203  Pet191_N  
Amino Acid Sequences MPSSCQELREALAQCLQESDCVMVQRNKASDCLREPLVDTLPTKCQQLKKGYGDCKRGMVDMRKRFRGNMPVAYRTLEGAAEDGKGYQLYAGKPAFAGGVKETSGHEPIPPDWRDVENENYRLEQQRQQRQQQQESRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.16
5 0.14
6 0.15
7 0.13
8 0.14
9 0.18
10 0.2
11 0.23
12 0.27
13 0.29
14 0.28
15 0.3
16 0.32
17 0.33
18 0.32
19 0.34
20 0.31
21 0.28
22 0.29
23 0.27
24 0.27
25 0.24
26 0.21
27 0.2
28 0.23
29 0.24
30 0.24
31 0.25
32 0.28
33 0.32
34 0.38
35 0.44
36 0.46
37 0.53
38 0.59
39 0.62
40 0.63
41 0.58
42 0.54
43 0.46
44 0.4
45 0.37
46 0.37
47 0.39
48 0.43
49 0.47
50 0.49
51 0.49
52 0.5
53 0.49
54 0.48
55 0.43
56 0.42
57 0.4
58 0.37
59 0.37
60 0.36
61 0.33
62 0.24
63 0.21
64 0.13
65 0.09
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.08
76 0.08
77 0.13
78 0.13
79 0.13
80 0.13
81 0.13
82 0.13
83 0.1
84 0.11
85 0.08
86 0.09
87 0.09
88 0.1
89 0.12
90 0.14
91 0.15
92 0.14
93 0.14
94 0.15
95 0.17
96 0.24
97 0.24
98 0.23
99 0.23
100 0.25
101 0.27
102 0.29
103 0.36
104 0.35
105 0.37
106 0.36
107 0.36
108 0.37
109 0.4
110 0.4
111 0.38
112 0.41
113 0.49
114 0.57
115 0.65
116 0.71
117 0.75
118 0.81
119 0.83