Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4L5Y9

Protein Details
Accession A0A2S4L5Y9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
257-281AAGFLLYRRRQQKKRSLRLACMEENHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046936  BIM1-like  
IPR046530  BIM1-like_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20238  DUF6595  
CDD cd21176  LPMO_auxiliary-like  
cd12087  TM_EGFR-like  
Amino Acid Sequences MRSVRTALAIGLAMASAAAAQHEHKVAKSPENPSTASVTDNYMGPAAFMWPADRVWSGDMDNQAPCGSRASPGNRTNFPLTGGAVALVAQDDYYKSKISISYSNDPTTNTDFSTLLETVDISDLNPGHTCAKVPDAPPRVAAGSNATLQIIYKADWDAPHNQTFYACADITYVTAADFKIRIPCFNATELGDDDKKTAANGSGSKQPPSGDSSGSGSGASDSGSSSNSGSGSGSSKLGAGAMAGAIIGSLAGASMLAAGFLLYRRRQQKKRSLRLACMEENARREQYPMDKVSPQRSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.03
5 0.03
6 0.04
7 0.06
8 0.09
9 0.13
10 0.14
11 0.15
12 0.23
13 0.26
14 0.34
15 0.39
16 0.43
17 0.46
18 0.49
19 0.49
20 0.44
21 0.44
22 0.37
23 0.32
24 0.27
25 0.23
26 0.2
27 0.19
28 0.18
29 0.14
30 0.13
31 0.11
32 0.1
33 0.08
34 0.08
35 0.07
36 0.08
37 0.08
38 0.09
39 0.11
40 0.11
41 0.11
42 0.12
43 0.14
44 0.14
45 0.16
46 0.19
47 0.19
48 0.18
49 0.18
50 0.17
51 0.16
52 0.15
53 0.14
54 0.12
55 0.13
56 0.19
57 0.24
58 0.33
59 0.38
60 0.43
61 0.43
62 0.47
63 0.47
64 0.42
65 0.38
66 0.3
67 0.25
68 0.19
69 0.17
70 0.13
71 0.09
72 0.08
73 0.06
74 0.05
75 0.04
76 0.03
77 0.04
78 0.04
79 0.07
80 0.08
81 0.09
82 0.09
83 0.1
84 0.13
85 0.16
86 0.21
87 0.26
88 0.32
89 0.35
90 0.37
91 0.36
92 0.35
93 0.35
94 0.33
95 0.27
96 0.2
97 0.17
98 0.16
99 0.16
100 0.18
101 0.15
102 0.11
103 0.1
104 0.1
105 0.08
106 0.09
107 0.08
108 0.04
109 0.06
110 0.06
111 0.07
112 0.07
113 0.08
114 0.09
115 0.09
116 0.09
117 0.08
118 0.12
119 0.14
120 0.15
121 0.22
122 0.25
123 0.26
124 0.26
125 0.26
126 0.23
127 0.21
128 0.2
129 0.14
130 0.11
131 0.11
132 0.11
133 0.1
134 0.09
135 0.08
136 0.09
137 0.07
138 0.06
139 0.06
140 0.06
141 0.07
142 0.08
143 0.1
144 0.14
145 0.17
146 0.19
147 0.19
148 0.18
149 0.18
150 0.18
151 0.17
152 0.14
153 0.11
154 0.09
155 0.09
156 0.09
157 0.09
158 0.08
159 0.07
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.06
166 0.13
167 0.14
168 0.14
169 0.17
170 0.2
171 0.21
172 0.22
173 0.23
174 0.17
175 0.19
176 0.19
177 0.19
178 0.17
179 0.15
180 0.15
181 0.14
182 0.13
183 0.11
184 0.11
185 0.09
186 0.11
187 0.13
188 0.15
189 0.23
190 0.25
191 0.26
192 0.26
193 0.25
194 0.23
195 0.26
196 0.25
197 0.18
198 0.18
199 0.2
200 0.19
201 0.19
202 0.17
203 0.12
204 0.11
205 0.1
206 0.09
207 0.06
208 0.05
209 0.06
210 0.07
211 0.07
212 0.07
213 0.08
214 0.08
215 0.08
216 0.08
217 0.09
218 0.1
219 0.11
220 0.11
221 0.1
222 0.1
223 0.1
224 0.1
225 0.08
226 0.06
227 0.05
228 0.04
229 0.04
230 0.03
231 0.03
232 0.03
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.02
243 0.02
244 0.03
245 0.03
246 0.03
247 0.06
248 0.12
249 0.14
250 0.22
251 0.32
252 0.43
253 0.51
254 0.61
255 0.7
256 0.76
257 0.85
258 0.88
259 0.87
260 0.85
261 0.86
262 0.83
263 0.76
264 0.71
265 0.66
266 0.6
267 0.56
268 0.53
269 0.46
270 0.39
271 0.37
272 0.37
273 0.39
274 0.42
275 0.43
276 0.43
277 0.47
278 0.52