Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4LA84

Protein Details
Accession A0A2S4LA84    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSRFQKRRHRLRLRAVDSVHydrophilic
76-105DKYTMFDRKAKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKKYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSRFQKRRHRLRLRAVDSVVATVDAALAKKGQTLEALERWKAEMPTEAEMLPRDKYTMFDRKAKKYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.29
9 0.36
10 0.45
11 0.56
12 0.61
13 0.7
14 0.78
15 0.82
16 0.87
17 0.9
18 0.9
19 0.88
20 0.9
21 0.9
22 0.85
23 0.8
24 0.69
25 0.6
26 0.5
27 0.41
28 0.3
29 0.19
30 0.13
31 0.07
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.06
41 0.06
42 0.08
43 0.1
44 0.15
45 0.17
46 0.16
47 0.16
48 0.17
49 0.18
50 0.16
51 0.14
52 0.14
53 0.14
54 0.16
55 0.17
56 0.16
57 0.15
58 0.16
59 0.17
60 0.14
61 0.12
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.63
72 0.69
73 0.72
74 0.73
75 0.79
76 0.82
77 0.85
78 0.85
79 0.87
80 0.87
81 0.88
82 0.87
83 0.87
84 0.82
85 0.81
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79