Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J7S1Z2

Protein Details
Accession J7S1Z2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-86RVRASFRSKVLKRRKEKGRWYLSHBasic
NLS Segment(s)
PositionSequence
53-81KRKRKFGFLARVRASFRSKVLKRRKEKGR
Subcellular Location(s) mito 20.5, cyto_mito 11.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSLLLSTVAGIARTRAVGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.07
8 0.07
9 0.07
10 0.06
11 0.05
12 0.06
13 0.05
14 0.04
15 0.04
16 0.05
17 0.05
18 0.06
19 0.07
20 0.08
21 0.12
22 0.16
23 0.24
24 0.27
25 0.28
26 0.3
27 0.36
28 0.39
29 0.46
30 0.51
31 0.52
32 0.57
33 0.58
34 0.63
35 0.6
36 0.61
37 0.59
38 0.58
39 0.6
40 0.58
41 0.65
42 0.59
43 0.65
44 0.68
45 0.68
46 0.71
47 0.68
48 0.72
49 0.66
50 0.68
51 0.61
52 0.57
53 0.53
54 0.44
55 0.41
56 0.42
57 0.44
58 0.51
59 0.6
60 0.66
61 0.7
62 0.77
63 0.83
64 0.83
65 0.89
66 0.89