Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KRF3

Protein Details
Accession A0A2S4KRF3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-94HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLFRTFSLPARIIGSRQSIGAFAGMSSSPATSWVPSLFANGASGWLAPVTRTIGGGFMQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKSNPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.29
4 0.23
5 0.22
6 0.21
7 0.17
8 0.17
9 0.16
10 0.12
11 0.07
12 0.08
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.08
19 0.09
20 0.08
21 0.09
22 0.09
23 0.1
24 0.1
25 0.11
26 0.1
27 0.09
28 0.1
29 0.08
30 0.09
31 0.07
32 0.07
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.06
39 0.05
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.12
52 0.11
53 0.11
54 0.13
55 0.22
56 0.28
57 0.36
58 0.4
59 0.47
60 0.54
61 0.58
62 0.64
63 0.64
64 0.66
65 0.68
66 0.73
67 0.76
68 0.78
69 0.82
70 0.82
71 0.82
72 0.83
73 0.83
74 0.84
75 0.81
76 0.79
77 0.78
78 0.73
79 0.68
80 0.65
81 0.58
82 0.51
83 0.44
84 0.36
85 0.36
86 0.39
87 0.46
88 0.49
89 0.54