Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KZ41

Protein Details
Accession A0A2S4KZ41   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
161-180GAGRKRKRGGRERDVKGVRRBasic
NLS Segment(s)
PositionSequence
163-200GRKRKRGGRERDVKGVRRKVGDAGEKPEQVAKRPKEKK
Subcellular Location(s) mito_nucl 10.833, mito 10.5, nucl 10, cyto_nucl 8.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039845  FAM192A  
IPR019331  FAM192A/Fyv6_N  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF10187  FAM192A_Fyv6_N  
Amino Acid Sequences MASRFVSCGTISSSGEVSKDATAATPQPEVSASAQPPLAKSTEWEAVQQELEAERKRRDEARLKAATGEEKSLYDVLQANKAAKQAAIEEQNKLKNQFRALDNDEAEFLDEVRERARREEERVRRETEDGLRAFRERQKGGGGGSDVVPEAGERLEEEQWGAGRKRKRGGRERDVKGVRRKVGDAGEKPEQVAKRPKEKKASVLVDYGSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.16
5 0.12
6 0.12
7 0.1
8 0.1
9 0.11
10 0.14
11 0.15
12 0.15
13 0.15
14 0.15
15 0.16
16 0.17
17 0.18
18 0.21
19 0.19
20 0.2
21 0.21
22 0.21
23 0.22
24 0.21
25 0.19
26 0.14
27 0.15
28 0.17
29 0.21
30 0.21
31 0.22
32 0.21
33 0.22
34 0.22
35 0.2
36 0.16
37 0.12
38 0.16
39 0.19
40 0.21
41 0.23
42 0.25
43 0.28
44 0.32
45 0.38
46 0.44
47 0.46
48 0.53
49 0.53
50 0.51
51 0.5
52 0.47
53 0.43
54 0.35
55 0.29
56 0.2
57 0.17
58 0.17
59 0.16
60 0.14
61 0.11
62 0.14
63 0.13
64 0.16
65 0.16
66 0.16
67 0.17
68 0.18
69 0.17
70 0.13
71 0.13
72 0.1
73 0.13
74 0.2
75 0.19
76 0.21
77 0.24
78 0.28
79 0.29
80 0.31
81 0.3
82 0.26
83 0.28
84 0.3
85 0.28
86 0.3
87 0.33
88 0.34
89 0.3
90 0.28
91 0.26
92 0.2
93 0.19
94 0.13
95 0.09
96 0.06
97 0.06
98 0.06
99 0.07
100 0.1
101 0.11
102 0.13
103 0.19
104 0.21
105 0.27
106 0.37
107 0.45
108 0.5
109 0.53
110 0.54
111 0.5
112 0.49
113 0.46
114 0.4
115 0.37
116 0.3
117 0.28
118 0.26
119 0.25
120 0.27
121 0.27
122 0.3
123 0.24
124 0.24
125 0.25
126 0.25
127 0.25
128 0.25
129 0.21
130 0.15
131 0.15
132 0.14
133 0.11
134 0.09
135 0.09
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.07
142 0.08
143 0.08
144 0.08
145 0.09
146 0.1
147 0.15
148 0.16
149 0.2
150 0.25
151 0.31
152 0.39
153 0.44
154 0.53
155 0.59
156 0.68
157 0.72
158 0.77
159 0.78
160 0.8
161 0.82
162 0.8
163 0.8
164 0.78
165 0.72
166 0.65
167 0.61
168 0.55
169 0.56
170 0.56
171 0.51
172 0.49
173 0.51
174 0.47
175 0.47
176 0.47
177 0.41
178 0.39
179 0.44
180 0.45
181 0.5
182 0.58
183 0.66
184 0.7
185 0.74
186 0.75
187 0.75
188 0.75
189 0.67
190 0.63
191 0.55
192 0.47