Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KN40

Protein Details
Accession A0A2S4KN40   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-106GTKLAKKKVDPKKPAPKKEGBasic
NLS Segment(s)
PositionSequence
82-198KGPSGGTKLAKKKVDPKKPAPKKEGVVAKKPAAKKAAPKKATAAKGEKKATTTAKKPAAPKKAAAPKKPAAAPKPEKPETVLTKTKSGRVAKTQKPAAKKAAPKKAAAPKKAAAAKA
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
IPR005818  Histone_H1/H5_H15  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00538  Linker_histone  
PROSITE View protein in PROSITE  
PS51504  H15  
CDD cd00073  H15  
Amino Acid Sequences MPPKKAEGAATKAKSGSAHASYQDMIVDAIVNLKDRNGSSRQSLKKYVKANNQLNVSDNMFDSLFNKALKTGVEKGVFAQPKGPSGGTKLAKKKVDPKKPAPKKEGVVAKKPAAKKAAPKKATAAKGEKKATTTAKKPAAPKKAAAPKKPAAAPKPEKPETVLTKTKSGRVAKTQKPAAKKAAPKKAAAPKKAAAAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.32
4 0.26
5 0.26
6 0.25
7 0.27
8 0.26
9 0.26
10 0.23
11 0.16
12 0.12
13 0.09
14 0.08
15 0.06
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.12
22 0.12
23 0.17
24 0.18
25 0.21
26 0.26
27 0.36
28 0.43
29 0.46
30 0.55
31 0.56
32 0.59
33 0.64
34 0.66
35 0.66
36 0.69
37 0.7
38 0.67
39 0.65
40 0.59
41 0.54
42 0.48
43 0.39
44 0.29
45 0.23
46 0.18
47 0.14
48 0.13
49 0.11
50 0.11
51 0.12
52 0.11
53 0.11
54 0.1
55 0.11
56 0.12
57 0.15
58 0.16
59 0.2
60 0.2
61 0.2
62 0.21
63 0.28
64 0.28
65 0.24
66 0.24
67 0.19
68 0.2
69 0.21
70 0.2
71 0.13
72 0.16
73 0.23
74 0.23
75 0.29
76 0.33
77 0.38
78 0.4
79 0.42
80 0.49
81 0.51
82 0.58
83 0.59
84 0.63
85 0.68
86 0.75
87 0.81
88 0.76
89 0.72
90 0.63
91 0.62
92 0.61
93 0.54
94 0.51
95 0.48
96 0.46
97 0.46
98 0.45
99 0.43
100 0.38
101 0.36
102 0.38
103 0.45
104 0.51
105 0.48
106 0.48
107 0.5
108 0.53
109 0.56
110 0.53
111 0.51
112 0.47
113 0.53
114 0.56
115 0.51
116 0.45
117 0.45
118 0.47
119 0.45
120 0.42
121 0.43
122 0.46
123 0.5
124 0.56
125 0.6
126 0.61
127 0.57
128 0.55
129 0.56
130 0.59
131 0.63
132 0.61
133 0.6
134 0.55
135 0.59
136 0.61
137 0.59
138 0.53
139 0.56
140 0.58
141 0.58
142 0.63
143 0.6
144 0.56
145 0.52
146 0.56
147 0.53
148 0.53
149 0.52
150 0.46
151 0.51
152 0.52
153 0.54
154 0.53
155 0.52
156 0.5
157 0.53
158 0.6
159 0.6
160 0.68
161 0.72
162 0.69
163 0.71
164 0.71
165 0.7
166 0.68
167 0.7
168 0.71
169 0.73
170 0.71
171 0.67
172 0.7
173 0.72
174 0.73
175 0.68
176 0.65
177 0.57
178 0.63