Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4L9X2

Protein Details
Accession A0A2S4L9X2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVKPLTFKGDKKPKKRKRDRDAAAADRPDBasic
NLS Segment(s)
PositionSequence
8-20KGDKKPKKRKRDR
214-235RFKPKLRASKEEKALARISRRE
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLTFKGDKKPKKRKRDRDAAAADRPDADGAPATKQLQRAGDEHGADDDDSWVSADAAADVVGPVMIVLPTDRPSALACDPGGKVFAMPIENIVDGNPTSAEPHDVRQVWVANRIAGTDSYRFKGHHGRYLACDKIGLLSATSEAVSPLECFTVIATADTPGTFQLQTLRDTFLAIKASPSSSSSSAAPAEVRGDADAITFATTFRIRMQARFKPKLRASKEEKALARISRRELEEAAGRRLGEDEVRVLKRARREGDFHEKLLDIKVKGKHDKFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.94
3 0.94
4 0.94
5 0.95
6 0.92
7 0.91
8 0.91
9 0.87
10 0.84
11 0.75
12 0.65
13 0.54
14 0.47
15 0.37
16 0.27
17 0.19
18 0.15
19 0.13
20 0.15
21 0.18
22 0.19
23 0.22
24 0.24
25 0.27
26 0.27
27 0.29
28 0.28
29 0.31
30 0.34
31 0.31
32 0.29
33 0.27
34 0.23
35 0.2
36 0.19
37 0.14
38 0.09
39 0.08
40 0.08
41 0.07
42 0.06
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.05
59 0.07
60 0.08
61 0.08
62 0.09
63 0.1
64 0.14
65 0.14
66 0.15
67 0.14
68 0.16
69 0.16
70 0.16
71 0.16
72 0.12
73 0.11
74 0.09
75 0.1
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.06
88 0.07
89 0.07
90 0.1
91 0.1
92 0.12
93 0.17
94 0.17
95 0.17
96 0.19
97 0.22
98 0.2
99 0.24
100 0.23
101 0.18
102 0.18
103 0.17
104 0.16
105 0.13
106 0.14
107 0.13
108 0.14
109 0.15
110 0.16
111 0.16
112 0.18
113 0.26
114 0.26
115 0.29
116 0.3
117 0.3
118 0.33
119 0.38
120 0.36
121 0.26
122 0.24
123 0.18
124 0.15
125 0.15
126 0.11
127 0.06
128 0.05
129 0.05
130 0.06
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.05
151 0.06
152 0.06
153 0.06
154 0.11
155 0.12
156 0.14
157 0.15
158 0.17
159 0.15
160 0.17
161 0.17
162 0.14
163 0.14
164 0.13
165 0.12
166 0.12
167 0.12
168 0.12
169 0.13
170 0.14
171 0.13
172 0.15
173 0.14
174 0.15
175 0.15
176 0.15
177 0.13
178 0.11
179 0.11
180 0.1
181 0.09
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.05
188 0.06
189 0.05
190 0.05
191 0.08
192 0.08
193 0.09
194 0.1
195 0.18
196 0.18
197 0.25
198 0.33
199 0.39
200 0.49
201 0.58
202 0.6
203 0.62
204 0.68
205 0.72
206 0.7
207 0.71
208 0.7
209 0.71
210 0.74
211 0.72
212 0.67
213 0.61
214 0.6
215 0.56
216 0.54
217 0.49
218 0.47
219 0.45
220 0.45
221 0.44
222 0.39
223 0.37
224 0.38
225 0.37
226 0.36
227 0.32
228 0.29
229 0.27
230 0.27
231 0.25
232 0.19
233 0.16
234 0.17
235 0.23
236 0.25
237 0.27
238 0.29
239 0.32
240 0.38
241 0.46
242 0.47
243 0.44
244 0.48
245 0.54
246 0.63
247 0.63
248 0.56
249 0.5
250 0.45
251 0.41
252 0.42
253 0.39
254 0.3
255 0.32
256 0.38
257 0.43
258 0.53