Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4L8W6

Protein Details
Accession A0A2S4L8W6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-40FINRHPPIQQHHTRRRNQIRFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 3, cyto 2, plas 2, golg 2
Family & Domain DBs
Amino Acid Sequences SFRNFASTTSRIVNQLHLFINRHPPIQQHHTRRRNQIRFEMPPKRMYVDGPGSRRAPKGFFGSTYETLTSSENAAVVRSIAVFGAAVALLSSSWGELLLPPYVPSTCASRFIDGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.3
5 0.3
6 0.3
7 0.39
8 0.35
9 0.34
10 0.31
11 0.32
12 0.35
13 0.42
14 0.49
15 0.49
16 0.59
17 0.67
18 0.73
19 0.8
20 0.84
21 0.83
22 0.79
23 0.78
24 0.75
25 0.74
26 0.76
27 0.74
28 0.65
29 0.6
30 0.56
31 0.48
32 0.4
33 0.33
34 0.3
35 0.29
36 0.32
37 0.31
38 0.33
39 0.33
40 0.35
41 0.35
42 0.31
43 0.24
44 0.21
45 0.23
46 0.2
47 0.19
48 0.21
49 0.25
50 0.25
51 0.25
52 0.22
53 0.18
54 0.18
55 0.18
56 0.15
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.03
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.07
85 0.08
86 0.09
87 0.09
88 0.11
89 0.12
90 0.13
91 0.13
92 0.17
93 0.18
94 0.25
95 0.27