Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4L076

Protein Details
Accession A0A2S4L076    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
383-409RTSSARVRARMMWRRRTRKVGRRAAETHydrophilic
NLS Segment(s)
PositionSequence
378-406MRRRARTSSARVRARMMWRRRTRKVGRRA
Subcellular Location(s) plas 22, E.R. 2, mito 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011701  MFS  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF07690  MFS_1  
Amino Acid Sequences MSNEYRDTAVLHLVVALTCFVVAFASAVVTANSEEVALLSFSLFVVGFGVRPIVFTPLLEIYGRRVIYGSTLLISVVFVIPCAAAKNIQTLLACRAIDGIAFSAPMTLARGTLADLWRNEERGVPMAAFSAGPFIGRASEIQLNFSDVVWILITFTVPETDTPTILARQAKKLRTSTGDSSHVTEQELDLRPLSERFAIFPIRPFQLLFGELIVFLISAYMSVLYGLLYMFFVGFPIIYPKGQALPQPSLQLKGPMVASCWFIPIGLFIFAWTSYLEISWAGPATGGFPAGFGFIFPYNSANNYLVDSYQHQAASALAAKTFIRSFWGAAVVLFTEQMYDCMGDQWGSTLLAFINLACCAIPFCSGSLGRGFGHGASMRRRARTSSARVRARMMWRRRTRKVGRRAAET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.06
5 0.06
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.04
12 0.05
13 0.05
14 0.06
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.09
37 0.08
38 0.08
39 0.09
40 0.12
41 0.12
42 0.11
43 0.15
44 0.14
45 0.16
46 0.15
47 0.15
48 0.15
49 0.21
50 0.21
51 0.18
52 0.17
53 0.16
54 0.18
55 0.19
56 0.16
57 0.11
58 0.11
59 0.11
60 0.1
61 0.1
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.08
72 0.09
73 0.13
74 0.14
75 0.16
76 0.16
77 0.17
78 0.19
79 0.22
80 0.21
81 0.17
82 0.18
83 0.15
84 0.15
85 0.13
86 0.11
87 0.06
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.07
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.12
100 0.13
101 0.15
102 0.16
103 0.2
104 0.22
105 0.23
106 0.22
107 0.2
108 0.2
109 0.19
110 0.19
111 0.14
112 0.13
113 0.12
114 0.12
115 0.1
116 0.08
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.09
126 0.13
127 0.13
128 0.15
129 0.15
130 0.16
131 0.16
132 0.16
133 0.13
134 0.08
135 0.09
136 0.07
137 0.07
138 0.05
139 0.05
140 0.05
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.09
147 0.1
148 0.1
149 0.11
150 0.12
151 0.11
152 0.14
153 0.19
154 0.17
155 0.25
156 0.31
157 0.34
158 0.38
159 0.4
160 0.4
161 0.4
162 0.43
163 0.39
164 0.38
165 0.39
166 0.35
167 0.36
168 0.33
169 0.29
170 0.24
171 0.2
172 0.15
173 0.16
174 0.17
175 0.14
176 0.13
177 0.13
178 0.13
179 0.13
180 0.14
181 0.1
182 0.08
183 0.09
184 0.11
185 0.13
186 0.13
187 0.15
188 0.17
189 0.16
190 0.16
191 0.15
192 0.14
193 0.13
194 0.13
195 0.11
196 0.08
197 0.07
198 0.07
199 0.07
200 0.05
201 0.04
202 0.03
203 0.03
204 0.02
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.06
224 0.07
225 0.07
226 0.08
227 0.08
228 0.1
229 0.12
230 0.14
231 0.15
232 0.18
233 0.2
234 0.24
235 0.24
236 0.24
237 0.23
238 0.23
239 0.19
240 0.17
241 0.17
242 0.13
243 0.14
244 0.13
245 0.15
246 0.12
247 0.13
248 0.11
249 0.1
250 0.09
251 0.09
252 0.08
253 0.07
254 0.07
255 0.06
256 0.07
257 0.07
258 0.08
259 0.07
260 0.06
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.07
274 0.06
275 0.06
276 0.06
277 0.06
278 0.06
279 0.05
280 0.07
281 0.07
282 0.08
283 0.08
284 0.1
285 0.1
286 0.12
287 0.15
288 0.14
289 0.14
290 0.14
291 0.14
292 0.13
293 0.14
294 0.15
295 0.14
296 0.16
297 0.15
298 0.14
299 0.13
300 0.13
301 0.14
302 0.15
303 0.14
304 0.11
305 0.12
306 0.12
307 0.14
308 0.15
309 0.12
310 0.12
311 0.13
312 0.14
313 0.14
314 0.16
315 0.14
316 0.13
317 0.14
318 0.11
319 0.1
320 0.09
321 0.08
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.07
328 0.08
329 0.09
330 0.08
331 0.08
332 0.09
333 0.09
334 0.09
335 0.09
336 0.08
337 0.08
338 0.08
339 0.09
340 0.07
341 0.08
342 0.07
343 0.08
344 0.07
345 0.07
346 0.07
347 0.08
348 0.1
349 0.09
350 0.1
351 0.15
352 0.15
353 0.17
354 0.18
355 0.2
356 0.18
357 0.19
358 0.19
359 0.14
360 0.18
361 0.2
362 0.23
363 0.27
364 0.36
365 0.4
366 0.44
367 0.46
368 0.46
369 0.52
370 0.57
371 0.61
372 0.63
373 0.68
374 0.71
375 0.71
376 0.72
377 0.71
378 0.71
379 0.71
380 0.7
381 0.71
382 0.74
383 0.81
384 0.86
385 0.88
386 0.89
387 0.89
388 0.9
389 0.9