Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KPM1

Protein Details
Accession A0A2S4KPM1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-58NSSAAFKMRAKWRKKRVRRLKRKRRKMRARSKBasic
NLS Segment(s)
PositionSequence
33-58KMRAKWRKKRVRRLKRKRRKMRARSK
Subcellular Location(s) mito 17, nucl 7, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MEHCLTSGISPASFLLHLIQTRFSSTNSSAAFKMRAKWRKKRVRRLKRKRRKMRARSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.11
4 0.12
5 0.12
6 0.14
7 0.13
8 0.16
9 0.17
10 0.15
11 0.17
12 0.17
13 0.22
14 0.2
15 0.22
16 0.19
17 0.2
18 0.22
19 0.2
20 0.24
21 0.29
22 0.36
23 0.43
24 0.53
25 0.63
26 0.71
27 0.8
28 0.86
29 0.88
30 0.91
31 0.94
32 0.95
33 0.96
34 0.96
35 0.97
36 0.97
37 0.97
38 0.97